DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and CCNC

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_005181.2 Gene:CCNC / 892 HGNCID:1581 Length:283 Species:Homo sapiens


Alignment Length:283 Identity:78/283 - (27%)
Similarity:130/283 - (45%) Gaps:49/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ETEKDLRILGCE-----------LIQTAGILLRLPQVAMATGQVLFQRFFYSKSFVRHNMETV-- 160
            |.:|||:.|..|           :||..|..|:|.|..:||..|.|:||     :.|::::::  
Human    24 ERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRF-----YARYSLKSIDP 83

  Fly   161 ---AMSCVCLASKIEE-----APRRIRDVINVFHHIKQVRAQKEISPMVLDPYYTNLKMQVIKAE 217
               |.:||.||||:||     ..|.|....:|..........||.      ||..|   .:::.|
Human    84 VLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEF------PYRMN---HILECE 139

  Fly   218 RRVLKELGFCVHVKHPHKLIVMYLQVLQYEKHEKLMQLSWNFMNDSLRTDVFMRYTPEAIACACI 282
            ..:|:.:..|:.|.||::.::.|:|.:..|  :.|:.|:|..:||:.|||:.:.|.|..||.||:
Human   140 FYLLELMDCCLIVYHPYRPLLQYVQDMGQE--DMLLPLAWRIVNDTYRTDLCLLYPPFMIALACL 202

  Fly   283 YLSARKLNIPLPNSPPWFGIFRVPMADITDICYRVMELYMRSKPVVEKLEAAVDELKKRYIDARN 347
            :::.   .:...::..||....|.|..|.:|...:::||.:.|...|:.|.|.         ..:
Human   203 HVAC---VVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMAT---------ILS 255

  Fly   348 KTKEANTPPAVITVDRNNGSHNA 370
            |..:...||........|||.|:
Human   256 KMPKPKPPPNSEGEQGPNGSQNS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 30/109 (28%)
CYCLIN 235..321 CDD:214641 23/85 (27%)
CCNCNP_005181.2 CYCLIN_CCNC_rpt1 40..146 CDD:410217 32/119 (27%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 28/95 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..283 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D453536at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.