DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and SSN8

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_014373.3 Gene:SSN8 / 855706 SGDID:S000004970 Length:323 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:62/220 - (28%)
Similarity:101/220 - (45%) Gaps:33/220 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LENSLIPEGKIDVTPSSQDGLD---------------HETEKDLRILGCELIQTAGILLRLPQVA 135
            ||..|.|:|...|..|.|:|::               ::.:.:|||....||...|..|.:.|.|
Yeast    31 LECQLFPQGLNIVMDSKQNGIEQSITKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYA 95

  Fly   136 MATGQVLFQRFFYSKSFVRHNMETVAMSCVCLASKIEEAPRRIRDVINVFHHIKQVRAQKEISPM 200
            :||..:...||....|....|:..:..:||.||.|:||.|:.||.:::         ..:.:.|.
Yeast    96 LATAHIYLSRFLIKASVREINLYMLVTTCVYLACKVEECPQYIRTLVS---------EARTLWPE 151

  Fly   201 VLDPYYTNLKMQVIKAERRVLKELGFCVHVKHPHKLIVMYLQVL-----QYEKHEKLMQLSWNFM 260
            .:.|..|    :|.:.|..:|:||...:.|.||::.:...:|||     |.......:|..|:.:
Yeast   152 FIPPDPT----KVTEFEFYLLEELESYLIVHHPYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLI 212

  Fly   261 NDSLRTDVFMRYTPEAIACACIYLS 285
            |||...||.:.|.|..||.||::::
Yeast   213 NDSYINDVHLLYPPHIIAVACLFIT 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 26/88 (30%)
CYCLIN 235..321 CDD:214641 17/56 (30%)
SSN8NP_014373.3 CCL1 27..323 CDD:227640 62/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.