DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and CTK2

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_012528.1 Gene:CTK2 / 853450 SGDID:S000003543 Length:323 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:56/266 - (21%)
Similarity:107/266 - (40%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ILLRLPQVAMATGQVLFQRFFYSKSFVRHNMETVAMSCVCLASKIEEAPRRIRDVINVFHHIKQV 191
            :.|:.|:..:.|....:||:.....|......|||.||:.|..|..|..::..|:..:...::.|
Yeast    51 VQLKFPRKTLETAVYFYQRYHLFNRFETEVCYTVATSCLTLGCKEVETIKKTNDICTLSLRLRNV 115

  Fly   192 RAQKEISPMVLDPYYTNLKMQVIKAERRVLKELGFCVHVK---HPHKLIVMYLQVLQYEKHEKLM 253
               .:|:..:|:    |.|.:|.:.|.|:|:...|...|.   |..:.::...:.|.::  .||.
Yeast   116 ---VKINTDILE----NFKKRVFQIELRILESCSFDYRVNNYVHIDEYVIKIGRELSFD--YKLC 171

  Fly   254 QLSWNFMNDSLRTDVFMRYTPEAIACACIYLSARKLNIPLPNSPPW----FGIFRVPMADITDIC 314
            .|:|....|:|:.:..:.....:||.|.:     |:...|.::..|    :.:|......:.:..
Yeast   172 NLAWVIAYDALKLETILVIPQHSIALAIL-----KIAYELLDNKNWSSKRYSLFETDEKSVNEAY 231

  Fly   315 YRVMELYMRSKPV--------VEKLEAAVD---ELKKRYIDARNKTKEANTP---------PAVI 359
            :.::..|:.|..:        .:.|...|:   ||||      |...|:..|         ...|
Yeast   232 FDIVNFYINSFDMCDLQRHLPADLLPIGVERFMELKK------NAGPESGLPQIPDHLLNADPYI 290

  Fly   360 TVDRNN 365
            |:.|:|
Yeast   291 TITRDN 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 17/75 (23%)
CYCLIN 235..321 CDD:214641 14/89 (16%)
CTK2NP_012528.1 CCL1 1..299 CDD:227640 56/266 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.