DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and CYCT1;3

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_174084.1 Gene:CYCT1;3 / 839655 AraportID:AT1G27630 Length:317 Species:Arabidopsis thaliana


Alignment Length:215 Identity:58/215 - (26%)
Similarity:102/215 - (47%) Gaps:21/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TPSSQDGLDHETEKDLRILGCELIQTAGILLRLPQVAMATGQVLFQRFFYSKSFVRHNMETVAMS 163
            :||.:||:|...|..||...|..:|..|:.|.:.||.::...|:..||:..:|..:::.:|:|.|
plant    45 SPSRKDGIDLVKESFLRSSYCTFLQRLGMKLHVSQVTISCAMVMCHRFYMRQSHAKNDWQTIATS 109

  Fly   164 CVCLASKIEEAPRRIRDVINVFHHI-------KQVRA-QKEISPMVLDPYYTNLKMQVIKAERRV 220
            .:.||.|.|:.|.::..|:...:.|       ..:|. |.|.        |...|..::..|..:
plant   110 SLFLACKAEDEPCQLSSVVVASYEIIYEWDPSASIRIHQTEC--------YHEFKEIILSGESLL 166

  Fly   221 LKELGFCVHVKHPHKLIVMYLQVLQYEKHEKLMQLSWNFMNDSLRTDVFMRYTPEAIACACIYLS 285
            |....|.:.::.|:|.:...|..|  .....|...:|||::|.:||.:.::|.|..||.|.::|:
plant   167 LSTSAFHLDIELPYKPLAAALNRL--NAWPDLATAAWNFVHDWIRTTLCLQYKPHVIATATVHLA 229

  Fly   286 ARKLNIPLPNSPPW---FGI 302
            |...|..:.:...|   ||:
plant   230 ATFQNAKVGSRRDWWLEFGV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 25/96 (26%)
CYCLIN 235..321 CDD:214641 21/71 (30%)
CYCT1;3NP_174084.1 CYCLIN_AcCycT_rpt1 50..173 CDD:410290 33/130 (25%)
CYCLIN_AcCycT_rpt2 177..266 CDD:410291 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.