DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and Ccnq

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_932106.1 Gene:Ccnq / 69109 MGIID:1916359 Length:250 Species:Mus musculus


Alignment Length:253 Identity:63/253 - (24%)
Similarity:118/253 - (46%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PSSQDGLDHETEKDLRILGCELIQTAGILLRLPQVAMATGQVLFQRFFYSKSFVRHNMETVAMSC 164
            |.:::....|.....|:  ...|..||:.|.:..:.:||...::.:||...:...:::..||||.
Mouse    16 PRAEERPAPEARVHFRV--TRFIMEAGVKLGMQSIPIATACTIYHKFFCEINLDAYDLYLVAMSS 78

  Fly   165 VCLASKIEEAPRRIRDVINVFHHIKQVRAQKEISPMVLDPYYTNLKMQVIKAERRVLKELGFCVH 229
            :.||.|:||...|.||:|||.|......::    |:.||..:..|:..:::.|..:|:.|.|.|.
Mouse    79 IYLAGKVEEQHLRTRDIINVSHRYFNPGSE----PLELDSRFWELRDSIVQCELLMLRVLRFQVS 139

  Fly   230 VKHPHKLIVMYLQVL-----QYE-KHEKLMQLSWNFMNDSLRTDVFMRYTPEAIACACIYLSARK 288
            .:||||.::.||..|     :|. :...:...:|..:.||....:.:|:..:.:|.|.:||:.:.
Mouse   140 FQHPHKYLLHYLISLKNWLNRYSWQRTPISVTAWALLRDSYHGGLCLRFQAQHLAVAVLYLALQV 204

  Fly   289 LNIPLP----NSPPWFGIFRVPMADITDICYRVMELYMRSKPVVEKLEAAVDELKKRY 342
            ..:.:|    ...||:.:|   ..|:|             ||:::.:   |.:|.:.|
Mouse   205 YGVEVPAEGEAEKPWWQVF---SDDLT-------------KPIIDNI---VSDLIQIY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 26/88 (30%)
CYCLIN 235..321 CDD:214641 19/95 (20%)
CcnqNP_932106.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 1/6 (17%)
CYCLIN 34..131 CDD:238003 29/100 (29%)
CCL1 35..248 CDD:227640 60/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.