DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and ccnh

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001016256.1 Gene:ccnh / 549010 XenbaseID:XB-GENE-922561 Length:323 Species:Xenopus tropicalis


Alignment Length:265 Identity:55/265 - (20%)
Similarity:103/265 - (38%) Gaps:72/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LPQVAMATGQVLFQRFFYSKSFVRHNMETVAMSCVCLASKIEEAPRRIRDVINVFHHIKQVRAQK 195
            :|:..:.|..:..:||:.:.|.:.|:...:.::||.||.|::|            .::..|:...
 Frog    75 MPKSVLGTACMYLKRFYLNNSVMEHHPRIIMLTCVFLACKVDE------------FNVSSVQFVG 127

  Fly   196 EISPMVLDPYYTNLKMQVIKAERRVLKELGFCVHVKHPHK-----LIVMYLQVLQYEKHEKLMQL 255
            .:....|.  ...:..|:::.|..::::|.|.:.|.:|::     ||.:..:....|..|.|.:.
 Frog   128 NLGENPLG--QEKILEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPMLENPEMLRKS 190

  Fly   256 SWNFMNDSLRTDVFMRYTPEAIACACIYLSARKLNIPLPNSPPWFGIFRVPMADITDICYRVME- 319
            :..|:|....||..:.:.|..||...|..:|.:..:.:.:.             :|: |..:.| 
 Frog   191 ADEFLNRVALTDACLLFAPSVIALTAILSTASRAGLNMESY-------------LTE-CLSLKEN 241

  Fly   320 ------LY---MRSKPVVEKLEAA----VDELKKR-------------------------YIDAR 346
                  ||   .|.|.:|.|.|.|    |..||||                         ||..:
 Frog   242 QETMSHLYDGMRRLKILVSKYEPARSDEVAVLKKRLENCHSTEVTLSINARKRKGYEDDGYISKK 306

  Fly   347 NKTKE 351
            .||:|
 Frog   307 PKTEE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 13/71 (18%)
CYCLIN 235..321 CDD:214641 17/97 (18%)
ccnhNP_001016256.1 ccl1 2..308 CDD:129660 52/260 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.