DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and ccnh

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_021331815.1 Gene:ccnh / 541325 ZFINID:ZDB-GENE-050320-13 Length:331 Species:Danio rerio


Alignment Length:220 Identity:46/220 - (20%)
Similarity:102/220 - (46%) Gaps:43/220 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 IPEGKIDVTPSSQDGLDHETEKDL------RILG-CELIQTAGILLRLPQVAMATGQVLFQRFFY 148
            :..||..:..|:.  |:.:.||.|      |:|. |.:.:..     :|:..:.|..:.|:||:.
Zfish    47 LSSGKPGINESTL--LNEQEEKVLFKHYEKRLLDFCAVFKPV-----MPKSVVGTACMYFRRFYL 104

  Fly   149 SKSFVRHNMETVAMSCVCLASKIEEAPRRIRDVINV-----FHHIKQVRAQKEISPMVLDPYYTN 208
            :.|.:.::..|:.::|..|:.|::|        .||     ..::::..|.:|   ..:|     
Zfish   105 NNSLMEYHPRTIMLTCAYLSCKVDE--------FNVSSTQFVGNLQESPAGQE---RAVD----- 153

  Fly   209 LKMQVIKAERRVLKELGFCVHVKHPHKLIVMYLQVLQ-----YEKHEKLMQLSWNFMNDSLRTDV 268
               |:::.|..::::|.|.:.|.:|::.:..:|..|:     .|..|.|.:.:.:|:|.:..||.
Zfish   154 ---QILEYELLLIQQLNFHLVVHNPYRPLEGFLIDLKTRYPLLENPEMLRKSAEDFLNRATMTDA 215

  Fly   269 FMRYTPEAIACACIYLSARKLNIPL 293
            .:.::|..||...:..||.:..:.:
Zfish   216 GLLFSPSQIALTAVLNSAARAGLKM 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 19/100 (19%)
CYCLIN 235..321 CDD:214641 14/64 (22%)
ccnhXP_021331815.1 CCL1 14..314 CDD:333358 46/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.