DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and ccnc

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_989157.2 Gene:ccnc / 394762 XenbaseID:XB-GENE-922006 Length:283 Species:Xenopus tropicalis


Alignment Length:289 Identity:80/289 - (27%)
Similarity:133/289 - (46%) Gaps:51/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ETEKDLRILGCE-----------LIQTAGILLRLPQVAMATGQVLFQRFFYSKSFVRHNMETV-- 160
            |.:|||:.|..|           :||..|..|:|.|..:||..|.|:||     :.|::::::  
 Frog    24 ERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRF-----YARYSLKSIDP 83

  Fly   161 ---AMSCVCLASKIEE-----APRRIRDVINVFHHIKQVRAQKEISPMVLDPYYTNLKMQVIKAE 217
               |.:||.||||:||     ..|.|....:|..........||.      ||..|   .:::.|
 Frog    84 VLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEF------PYRMN---HILECE 139

  Fly   218 RRVLKELGFCVHVKHPHKLIVMYLQVLQYEKHEKLMQLSWNFMNDSLRTDVFMRYTPEAIACACI 282
            ..:|:.:..|:.|.||::.::.|:|.:..|  :.|:.|:|..:||:.|||:.:.|.|..||.||:
 Frog   140 FYLLELMDCCLIVYHPYRPLLQYVQDMGQE--DMLLPLAWRIVNDTYRTDLCLLYPPFMIALACL 202

  Fly   283 YLSARKLNIPLPNSPPWFGIFRVPMADITDICYRVMELYMRSKPVVEKLEAAVDELKKRYIDARN 347
            :::.   .:...::..||....|.|..|.:|...:::||.:.|...|:.|.|.         ..|
 Frog   203 HVAC---VVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMAT---------ILN 255

  Fly   348 KTKEANTPPAVITVDRNNGSHNAWGGFIQ 376
            |..:...||........|||.::  |:.|
 Frog   256 KMPKPKPPPNSEGEQGTNGSQSS--GYSQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 30/109 (28%)
CYCLIN 235..321 CDD:214641 23/85 (27%)
ccncNP_989157.2 CCL1 1..269 CDD:227640 75/272 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..283 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D453536at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.