DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and Ccnq

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001020583.1 Gene:Ccnq / 303321 RGDID:1305651 Length:250 Species:Rattus norvegicus


Alignment Length:231 Identity:60/231 - (25%)
Similarity:111/231 - (48%) Gaps:33/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 IQTAGILLRLPQVAMATGQVLFQRFFYSKSFVRHNMETVAMSCVCLASKIEEAPRRIRDVINVFH 186
            |..||:.|.:..:.:||...::.:||...:...:::..||||.:.||.|:||...|.||:|||.|
  Rat    36 IMEAGVKLGMQSIPIATACTIYHKFFCEINLDAYDLYLVAMSSLYLAGKVEEQHLRTRDIINVSH 100

  Fly   187 HIKQVRAQKEISPMVLDPYYTNLKMQVIKAERRVLKELGFCVHVKHPHKLIVMYLQVL-----QY 246
            ......::    |:.||..:..|:..:::.|..:|:.|.|.|..:||||.::.||..|     :|
  Rat   101 RYFNPGSE----PLELDSRFWELRDSIVQCELLMLRVLRFQ
VSFQHPHKYLLHYLISLKNWLNRY 161

  Fly   247 E-KHEKLMQLSWNFMNDSLRTDVFMRYTPEAIACACIYLSARKLNIPLP----NSPPWFGIFRVP 306
            . :...:...:|..:.||....:.:|:..:.:|.|.:||:.:...:.:|    ...||:.:|   
  Rat   162 SWQRTPISVTAWALLRDSYHGGLCLRFQAQHLAVAVLYLALQVYGVEVPAEGEAEKPWWQVF--- 223

  Fly   307 MADITDICYRVMELYMRSKPVVEKLEAAVDELKKRY 342
            ..|:|             ||:::.:   |.:|.:.|
  Rat   224 SDDLT-------------KPIIDNI---VSDLIQIY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 25/80 (31%)
CYCLIN 235..321 CDD:214641 19/95 (20%)
CcnqNP_001020583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CYCLIN_CCNM_CCNQ_rpt1 29..137 CDD:410237 31/104 (30%)
CYCLIN_CCNM_CCNQ_rpt2 142..245 CDD:410238 27/121 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.