DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and SPAC1296.05c

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_593045.1 Gene:SPAC1296.05c / 2542980 PomBaseID:SPAC1296.05c Length:258 Species:Schizosaccharomyces pombe


Alignment Length:254 Identity:75/254 - (29%)
Similarity:133/254 - (52%) Gaps:19/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TLENSLIPEGKIDVTPSSQDGLDHETEKDLRILGCELIQTAGILLRLPQVAMATGQVLFQRF--F 147
            :|.:||....:::...|      .|..::|..||.|.||.||:||.|.|..:....:||:|:  .
pombe     4 SLVHSLASSSQLEAFDS------FEYAEELCTLGSEWIQEAGVLLNLTQNCVIVCLILFRRYCTL 62

  Fly   148 YSKSFVRHNMETVAMSCVCLASKIEEAPRRIRDVINVFHHIKQ------VRAQKEISPMVLDPYY 206
            |....  .:::.:.|:||.:.||..|.|..::|:.||..::|:      ..|:..|:..:.....
pombe    63 YPPRV--PDLDAIVMACVSIGSKTTETPASVQDICNVVVYLKERFKDTNFEARGFIAHDLYSEEM 125

  Fly   207 TNLKMQVIKAERRVLKELGFCVHVKHPHKLIVMYLQVLQYEKHEKLMQLSWNFMNDSLRTDVFMR 271
            .:.:.::...|..||:.|.|..|:..||||.:.|||.||...::||:|::|||:||:.||.:.:.
pombe   126 YSSRNRLSNMELEVLRALNFDTHIVIPHKLAIHYLQTLQLIDNKKLLQITWNFLNDASRTRLCVL 190

  Fly   272 YTPEAIACACIYLSARKLNIPLPNSPPWFGIFRVPMADITDICYRVMELYMRSKPVVEK 330
            |.|.::||.||.::||.:.:.||..  |:.:|.....:| |....::|.:.::..:..|
pombe   191 YPPFSLACGCIAMAARVIGMKLPKD--WYRVFDTTKEEI-DSLTSILENFYKTSAIAHK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 29/96 (30%)
CYCLIN 235..321 CDD:214641 32/85 (38%)
SPAC1296.05cNP_593045.1 CCL1 1..258 CDD:227640 75/254 (30%)
CYCLIN 34..103 CDD:238003 22/70 (31%)
CYCLIN 168..227 CDD:214641 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002258
OrthoInspector 1 1.000 - - oto101042
orthoMCL 1 0.900 - - OOG6_102010
Panther 1 1.100 - - LDO PTHR10026
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1832
SonicParanoid 1 1.000 - - X1491
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.