DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and ccnk-1

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_506615.2 Gene:ccnk-1 / 185704 WormBaseID:WBGene00009650 Length:252 Species:Caenorhabditis elegans


Alignment Length:251 Identity:72/251 - (28%)
Similarity:120/251 - (47%) Gaps:23/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PEGKIDVTPSSQDGLDHETEKDLRILGCELIQTAGILLRL-PQVAMATGQVLFQRFFYSKSFVRH 155
            |...:..|||.:.||..|.|...|..|.:|:...|..|.. |:..:....|.|.||:...||...
 Worm     7 PLEALKTTPSIRAGLTKEQELLWRREGIKLLSEVGNALNCKPRPTIGVAAVYFHRFYMIHSFQSF 71

  Fly   156 NMETVAMSCVCLASKIEEAPRRIRDVIN-VFHHIKQVRAQKEISPMVLDPYYTNLKMQVIKAERR 219
            :.|..|:||:.||.|:|:.|::.:||.. ...|..::.::           |.||...|:..||.
 Worm    72 SREVTALSCLFLAGKVEDFPKKCKDVCQAAVTHYPEIYSK-----------YQNLVDDVMGLERV 125

  Fly   220 VLKELGFCVHVKHPHKLIVMYLQVLQYEKHEKL---MQLSWNFMNDSLRTDVFMRYTPEAIACAC 281
            :|..|.|.:||..|:..::.|..:......||:   :|::|.|:|||:.|.:.:...|:.||.|.
 Worm   126 LLHSLKFDLHVALPYDALLDYKMMFPDMNREKITDAVQIAWTFINDSIYTTLCITTEPQMIAIAL 190

  Fly   282 IYLS-ARKLNIPLPNS--PPWFG--IFRVPMADITDICYRVMELY--MRSKPVVEK 330
            ::|: ..|...|:..:  |.|:.  :...|...:...|:.|::.|  .:.|||:||
 Worm   191 LHLAFTVKGYQPVQKNMDPCWWSADVSNWPQESVDKACHLVLDFYAATKEKPVLEK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 24/90 (27%)
CYCLIN 235..321 CDD:214641 22/93 (24%)
ccnk-1NP_506615.2 CCL1 12..250 CDD:227640 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.