DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and koko

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_732338.1 Gene:koko / 14462485 FlyBaseID:FBgn0264816 Length:259 Species:Drosophila melanogaster


Alignment Length:253 Identity:57/253 - (22%)
Similarity:107/253 - (42%) Gaps:52/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LRLPQVAMATGQVLFQRFFYSKSFVRHNMETVAMSCVCLASKI-EEAPRRIRDVINVFHHIKQVR 192
            |::..:..|...::|.|||.......::...:|...:.||.|| |:...:|||||||.:    ..
  Fly    47 LKMKPLTAACAAIVFHRFFREVKASDYDEFLIAAGSLYLAGKIKEDESVKIRDVINVAY----CT 107

  Fly   193 AQKEISPMVLDPYYTNLKMQVIKAERRVLKELGFCVHVKHPHKLIVMYLQVLQYEKHEKLMQLSW 257
            ..:...|:.|:..|.:::..:::||..:.:.|.|.:::...||.::.|::.||    :.:....|
  Fly   108 LNRGNDPVDLNDEYWSMRDAIVQAELLITRTLCFDLN
IDLAHKYLLHYMKTLQ----DWVGTEVW 168

  Fly   258 N----------FMNDSLRTDVFMRYTPEAIACACIYLSARKLNIPLPNSPPWFGIFRVPMADITD 312
            |          ::.|...:...::|.|..:|..|:.|:.:.           :|| :||:.|.:|
  Fly   169 NSVPIAKAAASYLQDFHHSANILKYKPTHVAIGCLSLALQT-----------YGI-QVPLTDESD 221

  Fly   313 ICYRVMELYMRSKPVVEKLEAAVDELKKRYIDARNKTKEANTPPAVITVDRNNGSHNA 370
                  |..|..||:|:..               .:..:......||.|.:|.|..||
  Fly   222 ------ESAMWYKPLVKDF---------------TRENQWEIIENVIEVYKNEGFLNA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 20/74 (27%)
CYCLIN 235..321 CDD:214641 19/95 (20%)
kokoNP_732338.1 Cyclin_N 6..144 CDD:278560 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453870
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10026
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.