DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16903 and Ccnc

DIOPT Version :9

Sequence 1:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001093942.1 Gene:Ccnc / 114839 RGDID:70905 Length:283 Species:Rattus norvegicus


Alignment Length:283 Identity:78/283 - (27%)
Similarity:130/283 - (45%) Gaps:49/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ETEKDLRILGCE-----------LIQTAGILLRLPQVAMATGQVLFQRFFYSKSFVRHNMETV-- 160
            |.:|||:.|..|           :||..|..|:|.|..:||..|.|:||     :.|::::::  
  Rat    24 ERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRF-----YARYSLKSIDP 83

  Fly   161 ---AMSCVCLASKIEE-----APRRIRDVINVFHHIKQVRAQKEISPMVLDPYYTNLKMQVIKAE 217
               |.:||.||||:||     ..|.|....:|..........||.      ||..|   .:::.|
  Rat    84 VLMAPTCVFLASKVEEFGVVSNTRLIAATTSVLKTRFSYAFPKEF------PYRMN---HILECE 139

  Fly   218 RRVLKELGFCVHVKHPHKLIVMYLQVLQYEKHEKLMQLSWNFMNDSLRTDVFMRYTPEAIACACI 282
            ..:|:.:..|:.|.||::.::.|:|.:..|  :.|:.|:|..:||:.|||:.:.|.|..||.||:
  Rat   140 FYLLELMDCCLIVYHPYRPLLQYVQDMGQE--DVLLPLAWRIVNDTYRTDLCLLYPPFMIALACL 202

  Fly   283 YLSARKLNIPLPNSPPWFGIFRVPMADITDICYRVMELYMRSKPVVEKLEAAVDELKKRYIDARN 347
            :::.   .:...::..||....|.|..|.:|...:::||.:.|...|:.|.|.         ..:
  Rat   203 HVAC---VVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMAT---------ILS 255

  Fly   348 KTKEANTPPAVITVDRNNGSHNA 370
            |..:...||........|||.|:
  Rat   256 KMPKPKPPPNSEGEQGPNGSQNS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 30/109 (28%)
CYCLIN 235..321 CDD:214641 23/85 (27%)
CcncNP_001093942.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 32/119 (27%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D453536at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.