DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4045 and AT5G17660

DIOPT Version :9

Sequence 1:NP_569978.1 Gene:CG4045 / 31176 FlyBaseID:FBgn0025629 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_568355.1 Gene:AT5G17660 / 831632 AraportID:AT5G17660 Length:312 Species:Arabidopsis thaliana


Alignment Length:239 Identity:66/239 - (27%)
Similarity:107/239 - (44%) Gaps:60/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YYRQRAHSNPIADHSFDYPARPEDVDWRSMY--PGIQQGQQVSFADIGCGYGGFLVTLGEMFPEK 96
            :.|.|.|.||::. ||..|| |..| |..:|  |.:.     ...|||.|.|.||:.......|.
plant    93 HVRIRQHVNPLSS-SFSKPA-PVPV-WDEVYKDPSLP-----LMVDIGSGSGRFLLWQANKNVES 149

  Fly    97 LS-IGMEIR---VKVSDYVVDRIAALRRRCADTGAYQNIACLRTNAM---KYLPNYFVKGQLEKM 154
            .: :|:|||   ||.:::.|:.:           ...|:..:..|||   ::|.:.: .|.||.:
plant   150 RNYLGLEIRQKLVKRANFWVNEL-----------GLSNVHFIFANAMVSFEHLISSY-PGPLEIV 202

  Fly   155 FFLYPDPHFKRAKHKWRIINQALLSEYAYILRKGGLLYTMTDVEDL----------HKWIVTHME 209
            ..|.||||||:...|.|::.:.|::.....|:.||.::..:||.|:          ...::.||:
plant   203 SILCPDPHFKKRHQKRRVVQKPLVNSILQNLKPGGKIFVQSDVLDVAQDMRDQLDEESNVLQHMD 267

  Fly   210 ----------EHPLYERLTEEEANADPITPKLYQSSEEGAKVVR 243
                      |:|:..| ||.|.:|:          .|||::.|
plant   268 TVDTEDGWLTENPMGIR-TEREIHAE----------FEGARIYR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4045NP_569978.1 Methyltransf_4 71..251 CDD:280538 52/200 (26%)
AT5G17660NP_568355.1 AdoMet_MTases 126..300 CDD:418430 51/201 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0220
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1417652at2759
OrthoFinder 1 1.000 - - FOG0002765
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100919
Panther 1 1.100 - - O PTHR23417
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.