DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtca and RCL1

DIOPT Version :9

Sequence 1:NP_001284801.1 Gene:Rtca / 31175 FlyBaseID:FBgn0025630 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_005763.3 Gene:RCL1 / 10171 HGNCID:17687 Length:373 Species:Homo sapiens


Alignment Length:368 Identity:96/368 - (26%)
Similarity:160/368 - (43%) Gaps:30/368 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SYLEGGGQALRNALSLSCILGKPVRVVKIRASRPSPGLSHQHLHGLNLLRDITNADVVGNYLLSS 76
            ||  .|...||..|.||.:.|:||::.||||...:|||.......:.||..|||...:......:
Human     9 SY--AGCNFLRQRLVLSTLSGRPVKIRKIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTGT 71

  Fly    77 TVEFTPRTILDNTYRVETHTAASITLIYQMALPVLLFAGRPSRLIVSGGTNVDFAPPVEYMQEVL 141
            |:.:.|..:...:...:......|....:..|.:..|...|.::::.|.||....|.|:.::...
Human    72 TLYYQPGLLYGGSVEHDCSVLRGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATA 136

  Fly   142 LPNLKHFGV---SFDLKVQRYGFYPRGQGRCQLDVQPVTK-LNSGKLVAFGRIKSVSGVAYCAGR 202
            ||.||.||:   ||:||:.|.|..|.|.|...... ||.| |...:|...|:||.:.|:||.. |
Human   137 LPLLKQFGIDGESFELKIVRRGMPPGGGGEVVFSC-PVRKVLKPIQLTDPGKIKRIRGMAYSV-R 199

  Fly   203 LPVNIAIDMQQTAQREIHRLWPSQQCSIEPIK--HSRQKAFHNGAGILMTVNTTSDVVLGASALG 265
            :...:|..:..:|:..:::..|......:.:|  :|.:..   |.|:.:...|||...|.|....
Human   200 VSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVNSGKSP---GFGLSLVAETTSGTFLSAELAS 261

  Fly   266 KKRIDGHV-----LGSEASCQLGDYMRKQVCVDDYMQDQLIIYMALAVGR---STMRTGKLTNHT 322
            ..:..|..     ||...:..|.:.:.:..|||...|...::.|.|  |:   |.:..|.|:.:|
Human   262 NPQGQGAAVLPEDLGRNCARLLLEEIYRGGCVDSTNQSLALLLMTL--GQQDVSKVLLGPLSPYT 324

  Fly   323 RTAINVAEQMTGVKFDVAMEP-------GGQMLVSCKGLGHVN 358
            ...:...:....:.|.:..:|       |.::|::|.|:|..|
Human   325 IEFLRHLKSFFQIMFKIETKPCGEELKGGDKVLMTCVGIGFSN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RtcaNP_001284801.1 RNA_3prim_cycl 7..338 CDD:274563 88/339 (26%)
RNA_Cyclase_Class_II 9..341 CDD:238446 89/342 (26%)
RCL1NP_005763.3 18S_RNA_Rcl1p 8..371 CDD:274564 96/368 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.