DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and fadH

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_417552.1 Gene:fadH / 947594 ECOCYCID:G36 Length:672 Species:Escherichia coli


Alignment Length:319 Identity:63/319 - (19%)
Similarity:109/319 - (34%) Gaps:97/319 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLRFRDEEFYKE---- 244
            |||.||:|..........|....|.....|         |....|: .:|:..: ||||:.    
E. coli   379 VVGAGPAGLAFAINAAARGHQVTLFDAHSE---------IGGQFNI-AKQIPGK-EEFYETLRYY 432

  Fly   245 --------YDIELWQGVAAEKLDTAQKELHCSNGYVVKYDKIYLATGCSAFRPPIPGVNLENVRT 301
                    ..::|...|.|::|..              :|:..||:|.....|||.|::...|.:
E. coli   433 RRMIEVTGVTLKLNHTVTADQLQA--------------FDETILASGIVPRTPPIDGIDHPKVLS 483

  Fly   302 VRELADTKAILASITPESRVVCLGSSFIALEAAAGLVSKVQSVTVVGRENVPLKAAF-------- 358
            ..::...||.:.     ::|..:|...|..:.|..|....:|.:    :|:   |.|        
E. coli   484 YLDVLRDKAPVG-----NKVAIIGCGGIGFDTAMYLSQPGESTS----QNI---AGFCNEWGIDS 536

  Fly   359 -----------GAEIGQRVLQLFEDNKVVMRMESGIAEIVG-----------------------N 389
                       |.:|.:...|:....:...:...|:.:..|                       :
E. coli   537 SLQQAGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKID 601

  Fly   390 EDGKVSEVVLVDDTR-LPCDLLILGTGSKLN---TQFLAKSGVKVNRNGSVDVTDFLES 444
            :||  ..||:..:|: |..|.:::..|.:.|   .|.|..||..|:..|..||...|::
E. coli   602 DDG--LHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDA 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 63/319 (20%)
Pyr_redox 320..402 CDD:278498 18/123 (15%)
Reductase_C 505..577 CDD:291425
fadHNP_417552.1 DCR_FMN 6..358 CDD:239240
FadH2 <355..665 CDD:223523 63/319 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.