DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and ahpF

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_415139.2 Gene:ahpF / 947540 ECOCYCID:EG11385 Length:521 Species:Escherichia coli


Alignment Length:344 Identity:85/344 - (24%)
Similarity:147/344 - (42%) Gaps:82/344 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RVEVGNEGQVMLRAKRSDLVNNKRLKNMVRRKPDDQRVFIVVGGGPSGAVA--------VET-IR 199
            :::.|.|       ||:....|||          |....::||.||:||.|        :.| :.
E. coli   194 KIDTGAE-------KRAAEELNKR----------DAYDVLIVGSGPAGAAAAIYSARKGIRTGLM 241

  Fly   200 QEGFTGRLI-FVCREDYLPYDRV---KISKAMNLEIEQLRFRDEEFYKEYDIELWQGVAAEKLDT 260
            .|.|.|::: .|..|:|:...:.   |::.|:.:.::           |||:::....:|.||..
E. coli   242 GERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVD-----------EYDVDVIDSQSASKLIP 295

  Fly   261 AQKE--LH---CSNGYVVKYDKIYLATGCSAFRPPIPGVNLENVRTVRELADTKAIL------AS 314
            |..|  ||   .::|.|:|...|.:|||.......:||         .:...||.:.      ..
E. coli   296 AAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPG---------EDQYRTKGVTYCPHCDGP 351

  Fly   315 ITPESRVVCLGSSFIALEAAAGLVSKVQSVTVVGRENVP-LKAAFGAEIGQRVLQLFEDNKVVMR 378
            :....||..:|.....:|||..|...|:.||::  |..| :||   .::.|..|:..::..:::.
E. coli   352 LFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLL--EFAPEMKA---DQVLQDKLRSLKNVDIILN 411

  Fly   379 MESGIAEIVGNEDGKVSEVV-LVDDTRLPCDL-------LILGTGSKLNTQFLAKSGVKVNRNGS 435
            .::  .|:.|  ||  |:|| |....|:..|:       :.:..|...||.:| :..|:.||.|.
E. coli   412 AQT--TEVKG--DG--SKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWL-EGAVERNRMGE 469

  Fly   436 VDVTDFLESNVPDVYVGGD 454
            :.:....|:||..|:..||
E. coli   470 IIIDAKCETNVKGVFAAGD 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560 2/9 (22%)
Pyr_redox_2 183..465 CDD:285266 77/305 (25%)
Pyr_redox 320..402 CDD:278498 24/83 (29%)
Reductase_C 505..577 CDD:291425
ahpFNP_415139.2 PRK15317 1..521 CDD:237942 85/344 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.