DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and lpd

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_414658.1 Gene:lpd / 944854 ECOCYCID:EG10543 Length:474 Species:Escherichia coli


Alignment Length:349 Identity:78/349 - (22%)
Similarity:139/349 - (39%) Gaps:88/349 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 IVVGGGPSGAVA--------VETIRQEGF--------------TGRLIFVCREDYLPYDRVKISK 225
            :|:|.||:|..|        :||:..|.:              :..|:.|.:.       ::.:|
E. coli    10 VVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKV-------IEEAK 67

  Fly   226 AM----------NLEIEQLRFRDEEFYKEYDI-ELWQGVAAEKLDTAQK--------------EL 265
            |:          ..:|:::|     .:||..| :|..|:|........|              |:
E. coli    68 ALAEHGIVFGEPKTDIDKIR-----TWKEKVINQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEV 127

  Fly   266 HCSNG-YVVKYDKIYLATGCSAFRP-PIPGVNLENVRTVRELADTKAILASITPESRVVCLGSSF 328
            ...|| .|:.:|...:|.|.   || .:|.:..|:.|.   ...|.|:.....|| |::.:|...
E. coli   128 EGENGKTVINFDNAIIAAGS---RPIQLPFIPHEDPRI---WDSTDALELKEVPE-RLLVMGGGI 185

  Fly   329 IALEAAAGLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQLFE---DNKVVMRMESGIAEIVGNE 390
            |.||......:....:.||...:..:.||     .:.::::|.   ..|..:.:|:.:..:...|
E. coli   186 IGLEMGTVYHALGSQIDVVEMFDQVIPAA-----DKDIVKVFTKRISKKFNLMLETKVTAVEAKE 245

  Fly   391 DGKVSEVVLVDDTRLPC-----DLLILGTGSKLNTQFL--AKSGVKVNRNGSVDVTDFLESNVPD 448
            ||   ..|.::..:.|.     |.:::..|...|.:.|  .|:||:|:..|.:.|...|.:|||.
E. coli   246 DG---IYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPH 307

  Fly   449 VYVGGDIANAHIHGLAHDRVNIGH 472
            ::..|||....:  |||..|:.||
E. coli   308 IFAIGDIVGQPM--LAHKGVHEGH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 73/340 (21%)
Pyr_redox 320..402 CDD:278498 16/84 (19%)
Reductase_C 505..577 CDD:291425
lpdNP_414658.1 PRK06467 3..472 CDD:180579 78/349 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.