DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and TRR2

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_011974.1 Gene:TRR2 / 856506 SGDID:S000001148 Length:342 Species:Saccharomyces cerevisiae


Alignment Length:345 Identity:65/345 - (18%)
Similarity:124/345 - (35%) Gaps:94/345 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 VNNKRLKNMVRRKPDDQRVFIVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLP--YDRV---- 221
            ::...|..|:..|      ..::|.||:...|.            |::.|.:..|  |:.:    
Yeast    16 ISKSVLSRMIHHK------VTIIGSGPAAHTAA------------IYLARAEMKPTLYEGMMANG 62

  Fly   222 -----KISKAMNLE--------------IEQLRFRDEEFYKEYDIELWQGVAAEKLDTAQKELHC 267
                 :::...::|              :|::|.:..:|......|     ...|:|.:.|....
Yeast    63 IAAGGQLTTTTDIENFPGFPESLSGSELMERMRKQSAKFGTNIITE-----TVSKVDLSSKPFRL 122

  Fly   268 -----SNGYVVKYDKIYLATGCSAFRPPIPGVNLENVRTVRELADTKAILASITPESR---VVCL 324
                 .:...|..|.|.||||.||.|..:||   |.....:.:: ..|:.....|..|   :..:
Yeast   123 WTEFNEDAEPVTTDAIILATGASAKRMHLPG---EETYWQQGIS-ACAVCDGAVPIFRNKPLAVI 183

  Fly   325 GSSFIALEAAAGLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQ-LFEDNKVVMRMESGIAEIVG 388
            |....|.|.|..|......|.::.|     |..|.|.:   ::| ..|.|..::.:.:.:| :..
Yeast   184 GGGDSACEEAEFLTKYASKVYILVR-----KDHFRASV---IMQRRIEKNPNIIVLFNTVA-LEA 239

  Fly   389 NEDGKVSEVVLVDDTR------LPCDLLILGTGSKLNTQFLAKSGVKVNRNGSVD--VTDFLE-- 443
            ..|||:..::.:.:|:      |..:.|....|....|..:         .|.||  .|.:::  
Yeast   240 KGDGKLLNMLRIKNTKSNVENDLEVNGLFYAIGHSPATDIV---------KGQVDEEETGYIKTV 295

  Fly   444 -----SNVPDVYVGGDIANA 458
                 ::||..:..||:.::
Yeast   296 PGSSLTSVPGFFAAGDVQDS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 62/325 (19%)
Pyr_redox 320..402 CDD:278498 18/85 (21%)
Reductase_C 505..577 CDD:291425
TRR2NP_011974.1 TRX_reduct 28..338 CDD:273540 63/333 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.