DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and AIF1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_014472.1 Gene:AIF1 / 855811 SGDID:S000005357 Length:378 Species:Saccharomyces cerevisiae


Alignment Length:305 Identity:68/305 - (22%)
Similarity:120/305 - (39%) Gaps:45/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 IVVGGGPSG-AVAVETIRQEGFTGRLIFVCREDYLPY----DRVKISKAMNLEIEQLRFRDEEFY 242
            :|||.|..| :||....|:.|.|..:..|...:|:.:    .|:.:||.....|..|:     ..
Yeast     9 VVVGAGVFGVSVANHLYRELGGTYAIKLVTASNYVYFLPSAVRLTVSKDYTKSILPLK-----NV 68

  Fly   243 KEYDIELWQGVAAEKLDTAQKELHCSNGYVVKYDKIYLATGCSAFRPPIPGVNLENVRTVRELAD 307
            .:..||:.:..||...|   ||:...:...:|:|.:.|||| |.:..|| |.........:|..:
Yeast    69 LDSGIEVIKDTAASFDD---KEVVLGSDRAIKFDILVLATG-SKWADPI-GSTYTFGDNYKEYFE 128

  Fly   308 TKAILASITPESRVVCLGSSFIALEAAAGLVSKVQSVTVVGRENV----------PLKAAFGAEI 362
            .:|  :.|:....::.||..|:..|.|..|:.|.......|::.:          |....:...:
Yeast   129 REA--SRISDADHILFLGGGFVNCELAGELLFKYLEEIRSGKKRISIIHNSDKLLPDSGLYNDTL 191

  Fly   363 GQRVLQLFEDNKVVMRMESGIAEIVGNEDGKVSEVVLVDDTR--LPCDLLILGTGSKLN------ 419
            .:.|......|.:.:.:.:..|.:    |.....:.|.:.:.  :..||:..|.|...|      
Yeast   192 RKNVTDYLSKNGITLYLNTVGASL----DTSPKRIFLGEGSSKYIDADLIYRGVGISPNVPVNSI 252

  Fly   420 TQFLAKSG-VKVNRNGSVDVTDFLESNVPDVYVGGDIANAHIHGL 463
            :....|.| ::|.:|..|...:     ..:|:..||:.|...|||
Yeast   253 SDLCDKKGFIQVEKNFRVKAVE-----AGNVFAIGDVTNFRYHGL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 68/305 (22%)
Pyr_redox 320..402 CDD:278498 14/91 (15%)
Reductase_C 505..577 CDD:291425
AIF1NP_014472.1 Pyr_redox_2 21..>293 CDD:423044 62/293 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.