DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and TRR1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_010640.1 Gene:TRR1 / 851955 SGDID:S000002761 Length:319 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:65/327 - (19%)
Similarity:114/327 - (34%) Gaps:94/327 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VVGGGPSGAVA--------VETIRQEGFT-------GRLIFVCREDYLP--YDRVKISKAMNLEI 231
            ::|.||:...|        ::.|..||..       |:|......:..|  .|.:..|:.|    
Yeast     8 IIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELM---- 68

  Fly   232 EQLRFRDEEFYKEYDIELWQGVAAEKLDTAQKELHC-----SNGYVVKYDKIYLATGCSAFRPPI 291
            :::|.:..:|..|...|     ...|:|.:.|....     .:...|..|.|.||||.||.|..:
Yeast    69 DRMREQSTKFGTEIITE-----TVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHL 128

  Fly   292 PGVNLENVRTVRELADTKAILASITPESRVVCLGSSFIALEAAAGLVSKVQSVTVVGRENVPLKA 356
            ||         .|....|.|.|.      .||        :.|..:........:.|.::...:|
Yeast   129 PG---------EETYWQKGISAC------AVC--------DGAVPIFRNKPLAVIGGGDSACEEA 170

  Fly   357 AFGAEIGQRVLQLF---------------EDNKVVMRMESGIAEIVGNEDGKVSEVVLV------ 400
            .|..:.|.:|..|.               |.|:.:..:.:.:| :....|||:...:.:      
Yeast   171 QFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYNTVA-LEAKGDGKLLNALRIKNTKKN 234

  Fly   401 DDTRLPCDLLILGTGSKLNTQFLAKSGVKVNRNGSVDVTD--FLE-------SNVPDVYVGGDIA 456
            ::|.||...|....|....|:.:|         |.||..:  :::       ::||..:..||:.
Yeast   235 EETDLPVSGLFYAIGHTPATKIVA---------GQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQ 290

  Fly   457 NA 458
            ::
Yeast   291 DS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 65/327 (20%)
Pyr_redox 320..402 CDD:278498 15/102 (15%)
Reductase_C 505..577 CDD:291425
TRR1NP_010640.1 TRX_reduct 5..315 CDD:273540 65/327 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.