DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and LPD1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_116635.1 Gene:LPD1 / 850527 SGDID:S000001876 Length:499 Species:Saccharomyces cerevisiae


Alignment Length:414 Identity:95/414 - (22%)
Similarity:167/414 - (40%) Gaps:107/414 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 MLRAKRSDLVNNKR-----LKNMVRRKPDDQRVFIVVGGGPSGAVAVETIRQEGFT-------GR 206
            |||.:  .|:||||     ::.:...|..|   .:::||||:|.||.....|.||.       |:
Yeast     1 MLRIR--SLLNNKRAFSSTVRTLTINKSHD---VVIIGGGPAGYVAAIKAAQLGFNTACVEKRGK 60

  Fly   207 LIFVC------------REDYLPYDR--------------VKIS-----KAMNLEIEQLRFRDEE 240
            |...|            ...:|.:..              :||:     ||.:..::||....|.
Yeast    61 LGGTCLNVGCIPSKALLNNSHLFHQMHTEAQKRGIDVNGDIKINVANFQKAKDDAVKQLTGGIEL 125

  Fly   241 FYKEYDIELWQG------------VAAEKLDTAQKELHCSNGYVVKYDKIYLATGCSAFRPPIPG 293
            .:|:..:..::|            ...:.|:...||.|     ::....|.:|||...  .|.||
Yeast   126 LFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVKEDH-----ILDVKNIIVATGSEV--TPFPG 183

  Fly   294 VNLENVRTVRELADTKAILASITPESRVVCLGSSFIALEAAAGLVSKVQS-VTVVGRENVP-LKA 356
            :.::..:.|   :.|.|:.....|: |:..:|...|.||..: :.|::.| ||||  |..| :.|
Yeast   184 IEIDEEKIV---SSTGALSLKEIPK-RLTIIGGGIIGLEMGS-VYSRLGSKVTVV--EFQPQIGA 241

  Fly   357 AFGAEIGQRVLQLFEDNKVVMRMESGIAEIVGNEDGKVSEVVLVDDTR------LPCDLLILGTG 415
            :...|:.:...:..:...:..::.:.:.....|:|..|.|:| |:||:      |..::|::..|
Yeast   242 SMDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIV-VEDTKTNKQENLEAEVLLVAVG 305

  Fly   416 SKLNTQFLA-----KSGVKVNRNGSVDVTDFLESNVPDVYVGGDIA-------NAHIHGLA---- 464
            .:   .::|     |.|::|::.|.:.:.|...|..|.:.|.||:.       .|...|:|    
Yeast   306 RR---PYIAGLGAEKIGLEVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEGIAAVEM 367

  Fly   465 ----HDRVNIGHYQLAQY-HGRVA 483
                |..||..:.....| |..||
Yeast   368 LKTGHGHVNYNNIPSVMYSHPEVA 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560 95/414 (23%)
Pyr_redox_2 183..465 CDD:285266 78/359 (22%)
Pyr_redox 320..402 CDD:278498 21/83 (25%)
Reductase_C 505..577 CDD:291425
LPD1NP_116635.1 Pyr_redox_2 24..498 CDD:423044 87/389 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.