DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and AIFM2

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001185625.1 Gene:AIFM2 / 84883 HGNCID:21411 Length:373 Species:Homo sapiens


Alignment Length:363 Identity:77/363 - (21%)
Similarity:141/363 - (38%) Gaps:81/363 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 IVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLR------FRDEEF 241
            ::||||..|..|...::...             :|:..|.:..:.:..:..||      |..:.|
Human    15 VIVGGGFGGIAAASQLQALN-------------VPFMLVDMKDSFHHNVAALRASVETGFAKKTF 66

  Fly   242 YKEYDI----ELWQGVAAEKLDTAQKELHCSNGYVVKYDKIYLATGCSAFRPPIPGVNLENVRTV 302
            . .|.:    ...||:.. .:|...:.:....|..:.:..:.||||.:.   |.||       ..
Human    67 I-SYSVTFKDNFRQGLVV-GIDLKNQMVLLQGGEALPFSHLILATGSTG---PFPG-------KF 119

  Fly   303 RELADTKAILASITPESR-------VVCLGSSFIALEAAAGL--------VSKVQS-VTVVGREN 351
            .|::..:|.:.:.....|       :|.:|.....:|.||.:        |:.:.| |.:..:|.
Human   120 NEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKEL 184

  Fly   352 VPLKAAFGAEIGQRVLQLFEDNKVVMRME---SGIAEIVGNEDGKVSEVVLVDDTRLPCDLLILG 413
            :|       .:.|.|.::.....|.:.:.   |.:.|:..||..:..:|.....|.:..:|:||.
Human   185 LP-------SVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILC 242

  Fly   414 TGSKLNTQFLAKS-GVKVNRNGSVDVTDFLE----SNVPDVYVGGDIANAHIHGLAHDRVNIGHY 473
            ||.|:|:....|: ..::..:|::.|.:.|:    ||   ||..||.|:.....:|:        
Human   243 TGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSN---VYAIGDCADVRTPKMAY-------- 296

  Fly   474 QLAQYHGRVAAINMCGGVKK--LEAV-PFFFTLIFGKG 508
             ||..|..:|..|:...||:  |:|. |...|.:...|
Human   297 -LAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 64/315 (20%)
Pyr_redox 320..402 CDD:278498 19/100 (19%)
Reductase_C 505..577 CDD:291425 1/4 (25%)
AIFM2NP_001185625.1 NirB 39..356 CDD:330997 70/326 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.