DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and AT1G71500

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_565018.1 Gene:AT1G71500 / 843491 AraportID:AT1G71500 Length:287 Species:Arabidopsis thaliana


Alignment Length:256 Identity:51/256 - (19%)
Similarity:91/256 - (35%) Gaps:90/256 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KEKSTGGAVGSYQSKCSNQSPSTTMSTEESSPDSEYTSAVPVDCRVTDLKENEMKQVDFDEDTRV 82
            |::| ||.|     :|  ::...:.|:..|:|...:...||:..    |.:.|.:.|..|::|.:
plant    54 KQRS-GGNV-----RC--EATEVSSSSSVSTPGRNWVPVVPLSA----LPKGERRVVIQDDETIL 106

  Fly    83 LLVKQNDRLLAVGAKCTHYGAPLQTGALGL-----GRVRCPWHGACFNLENGDIEDF-------- 134
            ||..:|| :.|:..:....|| ...|.|..     |.:.||...:.|:|..|:|.::        
plant   107 LLWYKND-VFAIENRSPAEGA-YSEGLLNARLTQDGCIVCPSTDSTFDLRTGEIREWYPKNPVLR 169

  Fly   135 ---PGLDSLPCYRVEVGNEGQVMLRAKRSDLVNNKRLKNMVRRKPDDQRVFIVVGGGPSGAVAVE 196
               |.|..|..|.|                             |.|::.::|.:........|.|
plant   170 VLTPALRKLFVYPV-----------------------------KYDEENIYISIRDSGKTEAAAE 205

  Fly   197 TI----RQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLRFRDEE------FYKEYDI 247
            .:    .|.|.|                     |.|:.::::|...:|      |.|:.::
plant   206 IVFSGKAQPGLT---------------------ATNVNVDEVRMIVDEGSEGFGFTKKNEV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560 26/110 (24%)
Pyr_redox_2 183..465 CDD:285266 12/75 (16%)
Pyr_redox 320..402 CDD:278498
Reductase_C 505..577 CDD:291425
AT1G71500NP_565018.1 Rieske_2 81..193 CDD:404659 30/146 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.