DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and NTRA

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_179334.5 Gene:NTRA / 816248 AraportID:AT2G17420 Length:383 Species:Arabidopsis thaliana


Alignment Length:308 Identity:68/308 - (22%)
Similarity:114/308 - (37%) Gaps:60/308 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VVGGGPSG-AVAVETIRQEGFTGRLIFVCREDYLPYDRV---KISKAMNLE-------------- 230
            :||.||:. ..|:...|.|  ...|:|   |.::..|..   :::...::|              
plant    63 IVGSGPAAHTAAIYASRAE--LKPLLF---EGWMANDIAPGGQLTTTTDVENFPGFPEGILGIDI 122

  Fly   231 IEQLRFRDEEFYKEYDIELWQGVAAEKLDTAQKELHC-SNGYVVKYDKIYLATGCSAFRPPIPGV 294
            :|:.|.:.|.|......|     ...|:|.:.|.... ::...|..|.:.::||..|.|....|.
plant   123 VEKFRKQSERFGTTIFTE-----TVNKVDFSSKPFKLFTDSRTVLADSVIISTGAVAKRLSFTGS 182

  Fly   295 NLENVRTVRELADTKAILASITPESR---VVCLGSSFIALEAAAGLVSKVQSVTVVGRENVPLKA 356
            ...|...........|:.....|..|   :|.:|....|:|.|..|......|.::.|.:     
plant   183 GEGNGGFWNRGISACAVCDGAAPIFRNKPLVVIGGGDSAMEEANFLTKYGSKVYIIHRRD----- 242

  Fly   357 AFGAE--IGQRVLQLFEDNKVVMRMESGIAEIVGNEDG------KVSEVVLVDDTRLPCDLLILG 413
            .|.|.  :.||.|   .:.|:.:...|.:.|..|:|:|      ||..||..|.:.|....|...
plant   243 TFRASKIMQQRAL---SNPKIEVIWNSAVVEAYGDENGRVLGGLKVKNVVTGDVSDLKVSGLFFA 304

  Fly   414 TGSKLNTQF------LAKSGVKVNRNGSVDVTDFLESNVPDVYVGGDI 455
            .|.:..|:|      |.:.|..|.:.|:.      :::|..|:..||:
plant   305 IGHEPATKFLDGQLELDEDGYVVTKPGTT------KTSVVGVFAAGDV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 68/308 (22%)
Pyr_redox 320..402 CDD:278498 24/92 (26%)
Reductase_C 505..577 CDD:291425
NTRANP_179334.5 TRX_reduct 60..372 CDD:273540 68/308 (22%)
NADB_Rossmann 62..243 CDD:304358 39/194 (20%)
Pyr_redox 212..280 CDD:278498 19/75 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.