DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and PYROXD1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_079130.2 Gene:PYROXD1 / 79912 HGNCID:26162 Length:500 Species:Homo sapiens


Alignment Length:380 Identity:78/380 - (20%)
Similarity:132/380 - (34%) Gaps:123/380 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 RKPDDQRVFIVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLRFRD 238
            |.|.....|:|||||.:|....|.:... |..       ||.|......:.||:. ..:|:    
Human     5 RPPPTAGKFVVVGGGIAGVTCAEQLATH-FPS-------EDILLVTASPVIKAVT-NFKQI---- 56

  Fly   239 EEFYKEYDIELWQGVAAEK-------LDTAQKEL----HC-----SNGYVVKYDKIYLATGCSAF 287
            .:..:|:|:|........|       :::..|:|    ||     .|.:|  |.|:.|   |:..
Human    57 SKILEEFDVEEQSSTMLGKRFPNIKVIESGVKQLKSEEHCIVTEDGNQHV--YKKLCL---CAGA 116

  Fly   288 RPPIPGVNLENVRTVRELADTKAILASITPESRVVCLGSSFIALEAAAGLVSKVQSVTVVGRENV 352
            :|.:.......|..:|:....:.....:|...|::.:|:..||||    ||.:::...|:..  :
Human   117 KPKLICEGNPYVLGIRDTDSAQEFQKQLTKAKRIMIIGNGGIALE----LVYEIEGCEVIWA--I 175

  Fly   353 PLKA-------AFGAEI---------------GQRVLQLFEDNKVVMRMESGIAEIVGNEDG--- 392
            ..||       |..||.               .:|.....|..|...|.:|. |:.||:..|   
Human   176 KDKAIGNTFFDAGAAEFLTSKLIAEKSEAKIAHKRTRYTTEGRKKEARSKSK-ADNVGSALGPDW 239

  Fly   393 ----------------------KVSEVVLVDDTRL------------------------------ 405
                                  :|.::.|.|:.|:                              
Human   240 HEGLNLKGTKEFSHKIHLETMCEVKKIYLQDEFRILKKKSFTFPRDHKSVTADTEMWPVYVELTN 304

  Fly   406 ----PCDLLILGTGSKLNTQ-FLAKSGVKVNRNGSVDVTDFLESNVPDVYVGGDI 455
                .||.::..||...|.: ||..:...:..:|.:.|.|.:.:::||:|..|||
Human   305 EKIYGCDFIVSATGVTPNVEPFLHGNSFDLGEDGGLKVDDHMHTSLPDIYAAGDI 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 75/371 (20%)
Pyr_redox 320..402 CDD:278498 25/128 (20%)
Reductase_C 505..577 CDD:291425
PYROXD1NP_079130.2 Pyr_redox_2 24..383 CDD:330998 69/361 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..235 7/24 (29%)
NirB <300..>494 CDD:330997 16/60 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.