DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and XB5959486

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001039183.1 Gene:XB5959486 / 734029 XenbaseID:XB-GENE-5959487 Length:424 Species:Xenopus tropicalis


Alignment Length:92 Identity:29/92 - (31%)
Similarity:46/92 - (50%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FDEDTR--VLLVKQNDRLLAVGAKCTHYGAPLQTGAL-----GLGRVRCPWHGACFNLENGDIED 133
            |.||..  ||:...:|:..|:.:.|.|.|.||:.|.:     |...:.||||...|.|::|  ..
 Frog    38 FSEDGEHLVLIHTTDDKFYAMDSSCPHEGGPLEQGDIEELCDGRLALTCPWHYFEFCLDDG--SS 100

  Fly   134 FPGLDSLPCYRVEVGNEGQVMLRAKRS 160
            ..||.: ..|.|:| .||:|.::.:.:
 Frog   101 STGLQN-QVYEVKV-YEGKVYIQTQNA 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560 28/84 (33%)
Pyr_redox_2 183..465 CDD:285266
Pyr_redox 320..402 CDD:278498
Reductase_C 505..577 CDD:291425
XB5959486NP_001039183.1 Rieske 21..120 CDD:239550 29/85 (34%)
DUF455 168..417 CDD:309440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.