DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and Sqor

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001155975.1 Gene:Sqor / 59010 MGIID:1929899 Length:450 Species:Mus musculus


Alignment Length:327 Identity:65/327 - (19%)
Similarity:110/327 - (33%) Gaps:86/327 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 IVVGGGPSG-AVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLRFRDEEFYKEYD 246
            :|:|||..| .:|....|:.|                       |.|:.|  :...:..||:   
Mouse    47 LVLGGGAGGITMATRMKRRVG-----------------------AENVAI--VEPSERHFYQ--- 83

  Fly   247 IELWQ--GVAAEKLDTAQKE-------------------------LHCSNGYVVKYDKIYLATGC 284
             .:|.  |..|::|..:.:.                         :...:|..:.|..:.:|.|.
Mouse    84 -PIWTLVGAGAKELSLSVRSTLSVIPSGVQWIQDRVAELNPDENCIRTDSGKEISYRYLIIALGI 147

  Fly   285 -----------SAFRPPIPGVNLENVRTV----RELADTKAILASIT-PESRVVCLGSS---FIA 330
                       ..|..|..|.|. :|:||    :.|...|...|..| |.:.|.|.|:.   ...
Mouse   148 QLDYEKIKGLPEGFAYPKIGSNY-SVKTVEKTWKALQGFKEGNALFTFPNTPVKCAGAPQKIMYL 211

  Fly   331 LEAAAGLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQ-LFEDNKVVMRMESGIAEIVGNEDGKV 394
            .||......|.....::  .|..|...||.:.....|| :..:..|.:..:..:.|:..::...|
Mouse   212 SEAYFRKTGKRPKANII--FNTALGTIFGVKKYADALQEIIRERDVSVNYKHNLIEVRPDKQEAV 274

  Fly   395 SEVV-LVDDTR-LPCDLLILGTGSKLNTQFLAKSGVKVNRNGSVDV--TDFLESNVPDVYVGGDI 455
            .|:: ...:|. :|.::|.: |........|.:|.| .:..|.|||  ........|:|:..||.
Mouse   275 FEILDKPGETHVIPYEMLHV-TPPMSAPDVLKRSPV-ADSAGWVDVDKETLQHKKYPNVFGIGDC 337

  Fly   456 AN 457
            .|
Mouse   338 TN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 65/327 (20%)
Pyr_redox 320..402 CDD:278498 16/86 (19%)
Reductase_C 505..577 CDD:291425
SqorNP_001155975.1 FadH2 46..397 CDD:223523 65/327 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.