DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and Txnrd1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001338913.1 Gene:Txnrd1 / 58819 RGDID:61959 Length:580 Species:Rattus norvegicus


Alignment Length:389 Identity:81/389 - (20%)
Similarity:139/389 - (35%) Gaps:125/389 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 IVVGGGPSGAVAV---------------------------------------ETIRQEGFTGRLI 208
            |::|||..|..|.                                       :.:.|....|:.:
  Rat    97 IIIGGGSGGLAAAKEAAKFDKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQAL 161

  Fly   209 FVCR------EDYLPYDRVKISKAMNLEIEQLRF------RDE---------EFYKEYDIELWQG 252
            ...|      ||.:.:|..|:::::...|..|.:      |::         :|...:.|.....
  Rat   162 KDSRNYGWKLEDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNN 226

  Fly   253 VAAEKLDTAQKELHCSNGYVVKY-----DKIYLATGCSAFR-PPIPGVNLENVRTVRELADTKAI 311
            ...||:.:|::.| .:.|...:|     ||.|..:....|. |..||                  
  Rat   227 KGKEKVYSAERFL-IATGERPRYLGIPGDKEYCISSDDLFSLPYCPG------------------ 272

  Fly   312 LASITPESRVVCLGSSFIALEAAAGLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQLFEDN--K 374
                    :.:.:|:|::|||.|..|......|||:.|.  .|...|..::..::.:..|::  |
  Rat   273 --------KTLVVGASYVALECAGFLAGIGLDVTVMVRS--ILLRGFDQDMANKIGEHMEEHGIK 327

  Fly   375 VVMR-MESGIAEIVGNEDGKV--------SEVVLVDDTRLPCDLLILGTGSKLNTQFLAKSGVKV 430
            .:.: :.:.|.:|.....|::        ||..:.|:....  ||.:|..|...|..|...|||:
  Rat   328 FIRQFVPTKIEQIEAGTPGRLKVTAKSTNSEETIEDEFNTV--LLAVGRDSCTRTIGLETVGVKI 390

  Fly   431 N-RNGSVDVTDFLESNVPDVYVGGDIANAHIHGLAHDRVNIGHYQL---AQYHGRVAAINMCGG 490
            | :.|.:.|||..::|||.:|..|||..             |..:|   |...||:.|..:.||
  Rat   391 NEKTGKIPVTDEEQTNVPYIYAIGDILE-------------GKLELTPVAIQAGRLLAQRLYGG 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 73/359 (20%)
Pyr_redox 320..402 CDD:278498 20/92 (22%)
Reductase_C 505..577 CDD:291425
Txnrd1NP_001338913.1 TGR 92..580 CDD:273624 81/389 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.