DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and SQOR

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001258142.1 Gene:SQOR / 58472 HGNCID:20390 Length:450 Species:Homo sapiens


Alignment Length:342 Identity:66/342 - (19%)
Similarity:110/342 - (32%) Gaps:116/342 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 IVVGGGPSG-AVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLRFRDEEFYKEYD 246
            :|:|||..| .:|....|:.|                       |.|:.|  :...:..||:   
Human    47 LVLGGGSGGITMAARMKRKVG-----------------------AENVAI--VEPSERHFYQ--- 83

  Fly   247 IELWQ--GVAAEKLDTAQKE-------------------------LHCSNGYVVKYDKIYLATGC 284
             .:|.  |..|::|.::.:.                         :|..:...:.|..:.:|.|.
Human    84 -PIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRYLIIALGI 147

  Fly   285 -----------SAFRPPIPGVNLENVRTV----RELADTKAILASIT-PESRVVCLGS--SFIAL 331
                       ..|..|..|.|. :|:||    :.|.|.|...|..| |.:.|.|.|:  ..:.|
Human   148 QLDYEKIKGLPEGFAHPKIGSNY-SVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYL 211

  Fly   332 EAA----AGLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQ-LFEDNKVVMRMESGIAEIVGNED 391
            ..|    .|..||...:.     |..|.|.||.:.....|| :.::..:.:..:..:.|:..::.
Human   212 SEAYFRKTGKRSKANIIF-----NTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQ 271

  Fly   392 GKV--------------SEVVLVDDTRLPCDLLILGTGSKLNTQFLAKSGVKVNRNGSVDV--TD 440
            ..|              .|::.|.....|.|:|              |:....:..|.|||  ..
Human   272 EAVFENLDKPGETQVISYEMLHVTPPMSPPDVL--------------KTSPVADAAGWVDVDKET 322

  Fly   441 FLESNVPDVYVGGDIAN 457
            ......|:|:..||..|
Human   323 LQHRRYPNVFGIGDCTN 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 66/342 (19%)
Pyr_redox 320..402 CDD:278498 19/102 (19%)
Reductase_C 505..577 CDD:291425
SQORNP_001258142.1 FadH2 56..398 CDD:223523 61/333 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.