DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and aifm2

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001186939.1 Gene:aifm2 / 557507 ZFINID:ZDB-GENE-050506-76 Length:373 Species:Danio rerio


Alignment Length:472 Identity:96/472 - (20%)
Similarity:165/472 - (34%) Gaps:165/472 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 DDQRVFIVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLR------ 235
            |:....::||||..|..|.:.::..|             :|:..:.:..|.:..:..||      
Zfish     8 DESVHVVIVGGGFGGIAAAQHLKHYG-------------VPFMLIDVLDAFHHNVAALRASVQTG 59

  Fly   236 FRDEEF--YKE-YDIELWQGVAAEKLDTAQKELHCSNGYVVKYDKIYLATGCSAFRPPIPGVNLE 297
            |..:.|  ||| :.:...|| ...::||..:.:...||..|:|..:.|.||.:...|        
Zfish    60 FARKTFIPYKETFGLNFLQG-RVIRIDTETQTVVLDNGKEVRYSHLILCTGTTGSFP-------- 115

  Fly   298 NVRTVRELADTKAILASITPESRVVCLGSSFIALEAAAGLVSKVQSVTVVGRENVPLKAAFGAEI 362
                              :..:.|....|:....|....::.:..::.|||      ....|.|:
Zfish   116 ------------------SKHNSVDTYKSAIQKYEDFFHVIKEANAIVVVG------GGTTGVEM 156

  Fly   363 GQRVLQLFEDNKVVM-----------------------RMESGIAEIVGNEDGKVSEVVL----- 399
            ...:...|.|.|||:                       .:|.|:..::|.:...:.|:.|     
Zfish   157 AAEIKTEFHDKKVVLIHPREEVADPELLPCVKEQAKQVLLEKGVELLLGQKVSNLEELELNVCRS 221

  Fly   400 ------VDDTRLPCDLLILGTGSKLNTQ--------FLAKSG-VKVNRNGSVDVTDFLESNVPDV 449
                  ..:.::..||:|..||||:|::        .||::| :|||::..|:..|       :|
Zfish   222 GMVVKTNKNEQVTTDLVICCTGSKINSEAYRSSMSSCLAENGALKVNKHLQVEGFD-------NV 279

  Fly   450 YVGGDIANAHIHGLAHDRVNIGHYQLAQYHGRVAAINMCGGVKKLEAVPFFFTLIFGKGIRYAGH 514
            |..||.||.....:|:.         |..|..|||.|:...:.             ||.:.    
Zfish   280 YAVGDCANLSEPKMAYH---------AGLHAGVAATNIINSLS-------------GKALT---- 318

  Fly   515 GSYKDVIIDGSMEDFKFVAYFINEADTVTAVASCGRDPIVAQF------AELISQGKCLGRGQIE 573
             |||                    ...||.:.:.|:|..|.||      ..|:::||.      |
Zfish   319 -SYK--------------------TGNVTMLIAMGKDAGVGQFNGYKLPRFLVTKGKS------E 356

  Fly   574 DPATREDWTKKLGQPLP 590
            .....:.| :::||..|
Zfish   357 GLLLWKSW-REMGQKAP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 68/333 (20%)
Pyr_redox 320..402 CDD:278498 18/115 (16%)
Reductase_C 505..577 CDD:291425 16/77 (21%)
aifm2NP_001186939.1 Pyr_redox_2 19..301 CDD:285266 67/343 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.