DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and dldh

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_958914.1 Gene:dldh / 399479 ZFINID:ZDB-GENE-040120-4 Length:507 Species:Danio rerio


Alignment Length:387 Identity:86/387 - (22%)
Similarity:143/387 - (36%) Gaps:88/387 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VVGGGPSGAVAVETIRQEGFTGRLIFVCRE-----------------------DYLPYDRV--KI 223
            |||.||.|.||.....|.||.    .||.|                       .|| |...  |.
Zfish    45 VVGSGPGGYVAAIKAAQLGFK----TVCVEKNATLGGTCLNVGCIPSKALLNNSYL-YHMAHGKD 104

  Fly   224 SKAMNLEIEQLRFRDEEFYKEYD---IELWQGVAAEKLDTAQKELHCSNGY-------------- 271
            .::..:||:.:....|:...:..   ..|..|:|  .|....|..|. ||:              
Zfish   105 FESRGIEIQGISLNLEKMMAQKSGAVKALTGGIA--HLFKQNKVTHV-NGFGTITGKNQVTAKTA 166

  Fly   272 ----VVKYDKIYLATGCSAFRPPIPGVNLENVRTVRELADTKAILASITPESRVVCLGSSFIALE 332
                |:....|.:|||...  .|.||:.::....|   :.|.|:.....||..:| :|:..|.:|
Zfish   167 DGEQVINTKNILIATGSEV--TPFPGIEIDEDSVV---SSTGALSLKNVPEELIV-IGAGVIGVE 225

  Fly   333 AAA---GLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQLFEDNKVVMRMESGIAEIVGNEDGKV 394
            ..:   .|.:||.:|..:|...   ......||.:...::.:...:..::.:.:.......|||:
Zfish   226 LGSVWQRLGAKVTAVEFLGHVG---GMGIDMEISKNFQRILQKQGLKFKLSTKVMGATKRPDGKI 287

  Fly   395 SEVVLV----DDTRLPCDLLILGTGSKLNTQFLA--KSGVKVNRNGSVDVTDFLESNVPDVYVGG 453
            ...|..    .:..|.||:|::..|.:..|..|.  ..|:::::.|.:.|....::|||::|..|
Zfish   288 DVAVEAAAGGKNETLTCDVLLVCIGRRPFTGNLGLESVGIELDKRGRIPVNGRFQTNVPNIYAIG 352

  Fly   454 DIAN----AH---------IHGLAHDRVNIGHY---QLAQYHGRVAAINMCGGVKKLEAVPF 499
            |:..    ||         :.|:|...|:|.:.   .:...|..||.:.......|.|.||:
Zfish   353 DVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKTEEQLKEEGVPY 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 76/348 (22%)
Pyr_redox 320..402 CDD:278498 15/88 (17%)
Reductase_C 505..577 CDD:291425
dldhNP_958914.1 PRK06327 42..507 CDD:235779 86/387 (22%)
NADB_Rossmann 44..220 CDD:304358 44/188 (23%)
Pyr_redox 214..286 CDD:278498 12/75 (16%)
Glycosyltransferase_GTB_type <282..376 CDD:299143 23/93 (25%)
Pyr_redox_dim 388..494 CDD:280934 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.