DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and pyroxd1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_957057.1 Gene:pyroxd1 / 393736 ZFINID:ZDB-GENE-040426-1732 Length:490 Species:Danio rerio


Alignment Length:382 Identity:80/382 - (20%)
Similarity:132/382 - (34%) Gaps:116/382 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SDLVNNKRLKNMVRRKPDDQRVFIVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKIS 224
            |.:.:.|::|            |::||||.:|....|.|..:              .|.|.|.:.
Zfish     4 SSMASEKQVK------------FVIVGGGIAGVTCAEQIASQ--------------FPSDEVCLL 42

  Fly   225 KAMNLEIEQLRFRD-EEFYKEYDIELWQG-VAAEK-------------LDTAQKELHCSNGYVVK 274
            .|..|..:...||. .:..:|:|||.... |..||             |...:..|...:|....
Zfish    43 TASPLVKKVTNFRQVSKTLEEFDIEEQPSRVLEEKYPNLKVLQSAVRLLKAREHLLETEDGQRFF 107

  Fly   275 YDKIYLATGCSAFRPPIPGVNLENVRTVRELADTKAILASITPESRVVCLGSSFIALEAAAGLVS 339
            |.|:.|   ||..||.:...:..:|..:|:....:.....::...|:|.:|:..||||    ||.
Zfish   108 YRKLCL---CSGGRPKLLSKDNPHVLGIRDTDSAQEFQKRLSTAKRIVVIGNGGIALE----LVY 165

  Fly   340 KVQSVTVVG--RENVPLKAAFGAEIGQRVLQLFEDNK-----VVMR----------------MES 381
            :|:...|:.  ::.......|.|...|.::...|.::     |..|                .|.
Zfish   166 EVEGCEVIWAVKDKAIGNTFFDAGAAQFLIPSLEADRREASSVCKRARYTTDSSAAGHSGSSSEL 230

  Fly   382 GIA------------------------------------EIVGNEDG-KVSE-------VVLVDD 402
            |.|                                    |::.:|.| |.:|       |.|.:.
Zfish   231 GSALGPDWHEGIELRGAKQSVRGVHIEYECEVEQIYTQQELLQSEHGTKTAELGVWPAYVQLTNG 295

  Fly   403 TRLPCDLLILGTGSKLNTQ-FLAKSGVKVNRNGSVDVTDFLESNVPDVYVGGDIANA 458
            ....||.::..||...||. ||..:...|..:..:.|.|.:.::..||:..||:.:|
Zfish   296 KIYGCDFIVSATGVVPNTDPFLPGNNFDVAADLGLLVDDHMRTSEADVFAAGDVCSA 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 76/359 (21%)
Pyr_redox 320..402 CDD:278498 27/148 (18%)
Reductase_C 505..577 CDD:291425
pyroxd1NP_957057.1 Pyr_redox_2 13..373 CDD:285266 78/373 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.