DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and aifm1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_005165182.1 Gene:aifm1 / 373125 ZFINID:ZDB-GENE-030826-11 Length:748 Species:Danio rerio


Alignment Length:411 Identity:95/411 - (23%)
Similarity:167/411 - (40%) Gaps:108/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 FIVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAM----------NLEIEQ--- 233
            ::::|||.:...|..:||......|::.:..|..|||.|..:||.:          :|..:|   
Zfish   271 YLLIGGGTASFAAARSIRARDPGARVLIITEESDLPYMRPPLSKELWFSDDPKVTESLRFKQWNG 335

  Fly   234 ----LRFRDEEFY-KEYDIELWQ--GVA------AEKLDTAQKELHCSNGYVVKYDKIYLATGCS 285
                :.|:...|| ...|:...:  |||      ...:|....::..|:|..:.|:|..:|||  
Zfish   336 KERSIYFQPPSFYVSPADLAKVENGGVAVLTDSKVVHMDVRGNKVKLSDGSEISYEKCLIATG-- 398

  Fly   286 AFRPPIPGV--NLENV---------RTV--RELADTKAILASITPESR-VVCLGSSFIALEAAAG 336
                   ||  ||:.:         ||.  |::.|.:: |..|:.|.: :..:|..|:..|.|..
Zfish   399 -------GVPRNLQVIDRAGEEVIKRTTLFRKIEDFRS-LEKISREVKSITIIGGGFLGSELACA 455

  Fly   337 LVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQLFED----NKVV-----------MRME------ 380
            |          ||.:        |:.|..|:|||.:    .||:           :|.|      
Zfish   456 L----------GRRS--------ADPGLEVMQLFPEKGNMGKVLPEYLSNWTTEKVRKEGVNVIT 502

  Fly   381 SGIAEIVGNEDGKVSEVVLVDDTRLPCDLLILGTGSKLNTQFLAKSGVKVNRN-GSVDVTDFLES 444
            ..:.:.|..::.|: |:.|.|...:..|.::...|.:.:.:....:|::|:.: |...|...|::
Zfish   503 DAVVKNVTYKNDKL-EIKLKDGRLVKTDHIVAAVGLEPSVELAKSAGLEVDSDFGGYRVNAELQA 566

  Fly   445 NVPDVYVGGDIANAHIHGLAHDRVNIGHYQLAQYHGRVAAINMCGGVKKLEAVPFFFTLIF---- 505
            . .:::|.||.|..:...|...||.  |:..|...||:|..||.|..|     |::...:|    
Zfish   567 R-SNIWVAGDAACFYDIKLGRRRVE--HHDHAVVSGRLAGENMTGANK-----PYWHQSMFWSDL 623

  Fly   506 GKGIRYAGHGSYKDVIIDGSM 526
            |..:.|...|     |:|.|:
Zfish   624 GPDVGYEAIG-----IVDSSL 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 76/343 (22%)
Pyr_redox 320..402 CDD:278498 21/103 (20%)
Reductase_C 505..577 CDD:291425 7/26 (27%)
aifm1XP_005165182.1 AIF-MLS <56..203 CDD:291623
Pyr_redox_2 274..584 CDD:285266 75/339 (22%)
Pyr_redox 439..523 CDD:278498 21/102 (21%)
AIF_C 602..728 CDD:291391 13/48 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.