DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and Trxr-1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_727251.1 Gene:Trxr-1 / 31760 FlyBaseID:FBgn0020653 Length:596 Species:Drosophila melanogaster


Alignment Length:411 Identity:86/411 - (20%)
Similarity:140/411 - (34%) Gaps:99/411 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 IVVGGGPSG-AVAVETIRQEGFTGRLIFV--------------------CREDYLPYDRVKISKA 226
            ||:|||.:| |.|.|.:........|.||                    |....|.:....:.:|
  Fly   118 IVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEA 182

  Fly   227 MNLEIEQLRFRDEEFYKEYDIELWQGVA--------AEKLDTAQKELHCSNGY------------ 271
            :: |.....:..:|..|....:|.|.|.        ..::|...|::...||.            
  Fly   183 VH-EAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAK 246

  Fly   272 ------VVKYDKIYLATGCSAFRPPIPGVNLENVRTVRELADTKAILASITPE-SRVVCLGSSFI 329
                  .:......:|.|.....|.|||        ..|...|...|.|:..| .:.:.:|:.:|
  Fly   247 LKSGERTITAQTFVIAVGGRPRYPDIPG--------AVEYGITSDDLFSLDREPGKTLVVGAGYI 303

  Fly   330 ALEAAAGLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQLFEDNKVVMRMESGIAEIVGNEDGKV 394
            .||.|..|.......||:.| ::.|: .|..::.:.|....|:..:....::....:...:|||:
  Fly   304 GLECAGFLKGLGYEPTVMVR-SIVLR-GFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKL 366

  Fly   395 ----SEVVLVDDTRLPCDLLILGTGSK-----LNTQFLAKSGVKVNRNGSVDVTDFLESNVPDVY 450
                ..|...::.....|.::...|.|     ||   |..:||.|.:: .:.|.....:||.::|
  Fly   367 LVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLN---LPNAGVTVQKD-KIPVDSQEATNVANIY 427

  Fly   451 VGGDIANAHIHG-------------LAHDRVNIGHYQLAQYHGRVAAI-----NMCGGVKKLEAV 497
            ..|||    |:|             |...|:..|..|...|......:     ..|.|:.:.:||
  Fly   428 AVGDI----IYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAV 488

  Fly   498 PFFFTLIFGKGIRYAGHGSYK 518
            .     .||.......||.||
  Fly   489 K-----QFGADEIEVFHGYYK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 72/351 (21%)
Pyr_redox 320..402 CDD:278498 17/85 (20%)
Reductase_C 505..577 CDD:291425 6/14 (43%)
Trxr-1NP_727251.1 TGR 113..595 CDD:273624 86/411 (21%)
NADB_Rossmann 115..>150 CDD:304358 12/31 (39%)
Pyr_redox 294..368 CDD:278498 16/75 (21%)
Pyr_redox_dim 468..577 CDD:280934 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.