DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and Dld

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_955417.1 Gene:Dld / 298942 RGDID:735073 Length:509 Species:Rattus norvegicus


Alignment Length:389 Identity:80/389 - (20%)
Similarity:150/389 - (38%) Gaps:101/389 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 KPDDQRVFIVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKI----SKAM-------- 227
            :|.|..| .|:|.||.|.||.....|.||  :.:.:.:.:.|....:.:    |||:        
  Rat    38 QPIDADV-TVIGSGPGGYVAAIKAAQLGF--KTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYH 99

  Fly   228 ----------NLEIEQLRFRDEEFYKEYDI---ELWQGVAAEKLDTAQKELHCSNGY-------- 271
                      .:||.::|...|:..::...   .|..|:|  .|....|.:|. ||:        
  Rat   100 LAHGKDFASRGIEIPEVRLNLEKMMEQKRSAVKALTGGIA--HLFKQNKVVHV-NGFGKITGKNQ 161

  Fly   272 -----------VVKYDKIYLATGCSAFRPPIPGVNLENVRTVRELADTKAILASITPESRVVCLG 325
                       |:....|.:|||...  .|.||:.::....|   :.|.|:.....|| ::|.:|
  Rat   162 VTATTADGSTQVIGTKNILIATGSEV--TPFPGITIDEDTIV---SSTGALSLKKVPE-KLVVIG 220

  Fly   326 SSFIALEAAA------GLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQLFEDNKVVMRMESGIA 384
            :..|.:|..:      ..|:.|:.:..||...:.:      ||.:...::.:......::.:.:.
  Rat   221 AGVIGVELGSVWQRLGADVTAVEFLGHVGGIGIDM------EISKNFQRILQKQGFKFKLNTKVT 279

  Fly   385 EIVGNEDGKV-----------SEVVLVDDTRLPCDLLILGTGSKLNTQFLA--KSGVKVNRNGSV 436
            ......|||:           :||:       .||:|::..|.:..||.|.  :.|::::..|.:
  Rat   280 GATKKSDGKIDVSVEAASGGKAEVI-------TCDVLLVCIGRRPFTQNLGLEELGIELDPKGRI 337

  Fly   437 DVTDFLESNVPDVYVGGDIANAHIHGLAHDRVNIGHYQLAQYHGRVAAINMCGGVKKLE--AVP 498
            .|....::.:|:::..||:....:  |||.         |:..|.:....|.||...::  .||
  Rat   338 PVNTRFQTKIPNIFAIGDVVAGPM--LAHK---------AEDEGIICVEGMAGGAVHIDYNCVP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 68/344 (20%)
Pyr_redox 320..402 CDD:278498 15/98 (15%)
Reductase_C 505..577 CDD:291425
DldNP_955417.1 lipoamide_DH 43..508 CDD:273568 78/384 (20%)
NADB_Rossmann 45..222 CDD:304358 41/187 (22%)
Pyr_redox 215..288 CDD:278498 11/78 (14%)
Pyr_redox_dim 390..496 CDD:280934 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.