DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and Pyroxd1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001004234.1 Gene:Pyroxd1 / 297708 RGDID:1303253 Length:498 Species:Rattus norvegicus


Alignment Length:379 Identity:77/379 - (20%)
Similarity:127/379 - (33%) Gaps:130/379 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 FIVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLRFRDEEFYKEYD 246
            |:|||||.:|....|.:        .|....||.|......:.||:. ..:|:    .:..:|:|
  Rat    10 FVVVGGGIAGVTCAEQL--------AINFPAEDILLVTASPVIKAVT-NFKQV----SKVLEEFD 61

  Fly   247 IELWQGVAAEK-------LDTAQKEL----HC---SNGYVVKYDKIYLATGCSAFRPPIPGVNLE 297
            :|.......|.       :::..|:|    ||   .:|....|.|:.|   |:..:|.:......
  Rat    62 VEEQPSTMLENRFPNIKVIESGVKQLKSDKHCIFTEDGREYVYKKLCL---CAGAKPKLICEGNP 123

  Fly   298 NVRTVRELADTKAILASITPESRVVCLGSSFIALE---------------------------AAA 335
            .|..:|:....:.....:|...|::.:|:..||||                           ||.
  Rat   124 YVLGIRDTDSAQEFQKQLTKARRIMIVGNGGIALELAYEVEVCEVIWAIKDKAIGNTFFDAGAAE 188

  Fly   336 GLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQLFEDNKVVMRMESGIAEIVGN----------- 389
            .|.|::.|      |....|.|.     :|.:...|:.|.....:|. |:.||:           
  Rat   189 FLTSRLLS------EKSEAKLAH-----KRTIYTVEEAKKETSTKSK-ADYVGSALGPDWHGGLA 241

  Fly   390 -------------------------EDGKV------------SEVVLVDDTRLP----------- 406
                                     |:.|:            .:.|.||....|           
  Rat   242 LKGTEEFSHSIHIETKCEVKKIYLQEEFKIMKKKSLAFPKDHHKSVTVDKEMWPVYVELTNGSIY 306

  Fly   407 -CDLLILGTGSKLNTQ-FLAKSGVKVNRNGSVDVTDFLESNVPDVYVGGDIANA 458
             ||.|:..||...|.| ||..:...:..:|.:.|.:.:.:::||:|..|||..|
  Rat   307 GCDFLVSATGVTPNVQPFLHGNDFDLGEDGGLRVDEQMRTSLPDIYAAGDICTA 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 76/378 (20%)
Pyr_redox 320..402 CDD:278498 25/156 (16%)
Reductase_C 505..577 CDD:291425
Pyroxd1NP_001004234.1 Pyr_redox_2 <76..381 CDD:285266 58/300 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.