DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and dld1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_593496.1 Gene:dld1 / 2543269 PomBaseID:SPAC1002.09c Length:511 Species:Schizosaccharomyces pombe


Alignment Length:480 Identity:96/480 - (20%)
Similarity:172/480 - (35%) Gaps:107/480 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CR--VTDLKENEMKQVDFDEDTRVLLVKQNDR----LLAVGAKCTHYGAPLQTGALGLGRV---- 115
            ||  .|.|:.:|.:....:...|:...|.:..    |..:|.....|.|.::...|||..:    
pombe    12 CRFKFTCLQVSECRPAQIEISKRLYSAKASGNGEYDLCVIGGGPGGYVAAIRGAQLGLKTICVEK 76

  Fly   116 RCPWHGACFNLENGDIEDFPGLDSLPCYRVEVGNEGQVMLRAKRSDLVNNKRLKNMVRRKPDDQR 180
            |....|.|.|:                        |.:..:|    |:||..:.:.|  |.|.:|
pombe    77 RGTLGGTCLNV------------------------GCIPSKA----LLNNSHIYHTV--KHDTKR 111

  Fly   181 VFIVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLRFRDEEFYKEY 245
            ..|.|.|     |:|                       :..::.||.:..::.|....|..:|:.
pombe   112 RGIDVSG-----VSV-----------------------NLSQMMKAKDDSVKSLTSGIEYLFKKN 148

  Fly   246 DIELWQGVAA--EKLDTAQKELHCSNGYVVKYDKIYLATGCSAFRPPIPGVNLENVRTVRELADT 308
            .:|..:|..:  :....:.|.:..:....:|.....:|||...  .|.|||.::..:.|   :.|
pombe   149 KVEYAKGTGSFIDPQTLSVKGIDGAADQTIKAKNFIIATGSEV--KPFPGVTIDEKKIV---SST 208

  Fly   309 KAILASITPESRVVCLGSSFIALEAAAGLVSKVQSVTVVGRENVP-LKAAFGAEIGQRVLQLFED 372
            .|:..|..|:...| ||...|.||..:........||||  |.:| :.....|:|.:.:.::...
pombe   209 GALSLSEVPKKMTV-LGGGIIGLEMGSVWSRLGAEVTVV--EFLPAVGGPMDADISKALSRIISK 270

  Fly   373 NKVVMRMESGIAEIVGNEDGKVSEVVLVDDTR---LPCDLLILGTGSKLNTQFLA--KSGVKVNR 432
            ..:..:..:.:.....|.|....|:..:.:.:   ...|:|::..|....|:.|.  |.|:.:::
pombe   271 QGIKFKTSTKLLSAKVNGDSVEVEIENMKNNKRETYQTDVLLVAIGRVPYTEGLGLDKLGISMDK 335

  Fly   433 NGSVDVTDFLESNVPDVYVGGDIA-------NAHIHGLA--------HDRVNIGHYQLAQY-HGR 481
            :..|.:.....:|:|.:.|.||..       .|...|:|        ...||........| |..
pombe   336 SNRVIMDSEYRTNIPHIRVIGDATLGPMLAHKAEDEGIAAVEYIAKGQGHVNYNCIPAVMYTHPE 400

  Fly   482 VAAINMC------GGVK-KLEAVPF 499
            ||.:.:.      .|:| ::...||
pombe   401 VAWVGITEQKAKESGIKYRIGTFPF 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560 19/102 (19%)
Pyr_redox_2 183..465 CDD:285266 59/304 (19%)
Pyr_redox 320..402 CDD:278498 17/82 (21%)
Reductase_C 505..577 CDD:291425
dld1NP_593496.1 PRK06327 45..511 CDD:235779 89/447 (20%)
NAD_binding_8 50..>84 CDD:290186 8/33 (24%)
Pyr_redox 219..297 CDD:278498 17/80 (21%)
Pyr_redox_dim 392..498 CDD:280934 8/34 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.