DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and Pyroxd1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_898988.2 Gene:Pyroxd1 / 232491 MGIID:2676395 Length:498 Species:Mus musculus


Alignment Length:386 Identity:79/386 - (20%)
Similarity:128/386 - (33%) Gaps:132/386 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 PDDQRVFIVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLRFRD-E 239
            |.....|:|||||.:|....|.:        .:....||.|......:.||:.      .||. .
Mouse     4 PRPAGTFVVVGGGIAGVTCAEQL--------AVSFPEEDILLVTASPVIKAVT------NFRQVS 54

  Fly   240 EFYKEYDIELWQGVAAEK-------LDTAQKEL----HC---SNGYVVKYDKIYLATGCSAFRPP 290
            :..:|:|:|...|...|.       :::..|:|    ||   .:|....|.|:.|   |:..:|.
Mouse    55 KVLEEFDVEEQPGTMLESRFPNIKVIESGVKQLKSEDHCIFTEDGREFVYKKLCL---CAGAKPK 116

  Fly   291 IPGVNLENVRTVRELADTKAILASITPESRVVCLGSSFIALE----------------------- 332
            :.......|..:|:....:.....:....|::.:|:..||||                       
Mouse   117 LIYEGNPRVLGIRDTDSAQEFQKELAKARRIMIVGNGGIALELAYEIEGCEVVWAIKDNAIGNTF 181

  Fly   333 ----AAAGLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQLFEDNKVVMRMESGIAEIVGN---- 389
                ||..|.||:.|      |....|.|.     :|.:...|:.|...|.:|. |:.||:    
Mouse   182 FDAGAAEFLTSKLMS------EKSEAKIAH-----KRTIYTVEEAKKETRTKSK-ADYVGSALGP 234

  Fly   390 --------------------------------EDGKVSE------------------------VV 398
                                            |:.|:.:                        |.
Mouse   235 DWHGGLALKGTEEFSHSVHIETRCEVKKIYLEEEFKIMKKKSLAFPKDHHKSVTADKEMWPVYVE 299

  Fly   399 LVDDTRLPCDLLILGTGSKLNTQ-FLAKSGVKVNRNGSVDVTDFLESNVPDVYVGGDIANA 458
            |.:.|...||.|:..||...|.. ||.::...:..:|.:.|.|.:.:::||:|..|||..|
Mouse   300 LTNGTIYGCDFLVSATGVTPNVHPFLHRNNFALGEDGGLRVDDQMRTSLPDIYAAGDICTA 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 77/379 (20%)
Pyr_redox 320..402 CDD:278498 27/168 (16%)
Reductase_C 505..577 CDD:291425
Pyroxd1NP_898988.2 Pyr_redox_2 <76..381 CDD:285266 58/300 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.