DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and gsr-1

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001021220.1 Gene:gsr-1 / 175467 WormBaseID:WBGene00008117 Length:473 Species:Caenorhabditis elegans


Alignment Length:325 Identity:68/325 - (20%)
Similarity:121/325 - (37%) Gaps:79/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 FIVVGGGPSGAVAVETIRQEGF------TGRLIFVC-----------------------REDY-- 215
            ::|:|||..|..:....|:.|.      :|||...|                       ..||  
 Worm    23 YLVIGGGSGGIASARRAREFGVSVGLIESGRLGGTCVNVGCVPKKVMYNCSLHAEFIRDHADYGF 87

  Fly   216 ----LPYDRVKISKAMNLEIEQLRFRDEEFYKEYDIELWQGVAAEKLDTAQKELHCSNGYVVKYD 276
                ..:|...|.|:.:..|::|....|...|...:|..:|.|....|...:    .||...:..
 Worm    88 DVTLNKFDWKVIKKSRDEYIKRLNGLYESGLKGSSVEYIRGRATFAEDGTVE----VNGAKYRGK 148

  Fly   277 KIYLATGCSAFRPPIPGVNLENVRTVRELADTKAILASITPESRVVCLGSSFIALEAAAGLVSKV 341
            ...:|.|   .:|.||     |::......|:..........||.|.:|:.:||:| .||:::.:
 Worm   149 NTLIAVG---GKPTIP-----NIKGAEHGIDSDGFFDLEDLPSRTVVVGAGYIAVE-IAGVLANL 204

  Fly   342 QSVT--------VVGRENVPLKAAFGAEIGQRVLQLFEDNKVVMRMESGIAEIVGNEDG----KV 394
            .|.|        |:...:..|.....|::.:      |.|.:.:...:.:.|::..:||    |.
 Worm   205 GSDTHLLIRYDKVLRTFDKMLSDELTADMDE------ETNPLHLHKNTQVTEVIKGDDGLLTIKT 263

  Fly   395 SEVVLVDDTRLPCDLLILGTG-----SKLNTQFLAKSGVKVNRNGSVDVTDFLESNVPDVYVGGD 454
            :..|:.     ....||...|     .:||   |.:.|||.:::|.:.|.::..::.|.:...||
 Worm   264 TTGVIE-----KVQTLIWAIGRDPLTKELN---LERVGVKTDKSGHIIVDEYQNTSAPGILSVGD 320

  Fly   455  454
             Worm   321  320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 68/324 (21%)
Pyr_redox 320..402 CDD:278498 20/93 (22%)
Reductase_C 505..577 CDD:291425
gsr-1NP_001021220.1 PRK06116 19..467 CDD:235701 68/325 (21%)
Pyr_redox 184..261 CDD:278498 18/83 (22%)
Pyr_redox_dim 357..465 CDD:280934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.