DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4199 and Gsr

DIOPT Version :9

Sequence 1:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_446358.2 Gene:Gsr / 116686 RGDID:621747 Length:410 Species:Rattus norvegicus


Alignment Length:213 Identity:55/213 - (25%)
Similarity:86/213 - (40%) Gaps:49/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 NGYVVKYDKIYLATGCSAFRP---PIPGVNLENVRTVRELADTKAILASITPE---------SRV 321
            ||.......|.:|||.....|   .|||.:|                 .||.:         ||.
  Rat    75 NGKKFTAPHILIATGGVPTVPHENQIPGASL-----------------GITSDGFFQLEDLPSRS 122

  Fly   322 VCLGSSFIALEAAAGLVSKVQSVTVVGRENVPLKAAFGAEI-----------GQRVLQLFEDNKV 375
            |.:|:.:||:| .||::|.:.|.|.:...:..:..:|.:.|           |..||: |...|.
  Rat   123 VIVGAGYIAVE-IAGILSALGSKTSLMIRHDKVLRSFDSLISSNCTEELENAGVEVLK-FSQVKE 185

  Fly   376 VMRMESGI-AEIVGNEDGKVSEVVLVDDTRLPCDLLILGTGSKLNTQ--FLAKSGVKVNRNGSVD 437
            |.:..||: ..:|....|:...|..:.|.    |.|:...|...|::  .|.|.|::.:..|.:.
  Rat   186 VKKTPSGLELHVVTALPGRKPTVTTIPDV----DCLLWAIGRDPNSKGLNLNKLGIQTDDKGHIL 246

  Fly   438 VTDFLESNVPDVYVGGDI 455
            |.:|..:||..||..||:
  Rat   247 VDEFQNTNVKGVYAVGDV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 55/213 (26%)
Pyr_redox 320..402 CDD:278498 24/93 (26%)
Reductase_C 505..577 CDD:291425
GsrNP_446358.2 gluta_reduc_1 1..410 CDD:273614 55/213 (26%)
Pyr_redox 121..197 CDD:278498 21/77 (27%)
Pyr_redox_dim 300..408 CDD:280934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.