DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4281 and Gpatch2l

DIOPT Version :9

Sequence 1:NP_569973.1 Gene:CG4281 / 31171 FlyBaseID:FBgn0025626 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_001128031.1 Gene:Gpatch2l / 314325 RGDID:1308907 Length:474 Species:Rattus norvegicus


Alignment Length:459 Identity:97/459 - (21%)
Similarity:162/459 - (35%) Gaps:144/459 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 RKRSNRDRYHEQDSVKLYALPHSQVDDQHVEQPQHQQQRMRPRSYSSTSKPLSDRLLPLNKGLLS 266
            |||..|.|..:...:..:|...|:..:..:::.....:.:.|.:..|.|   .|.::......||
  Rat    40 RKRRGRKRRSDFTHLAEHACCFSEASESSLDEATKDCREVAPLTNFSDS---DDTVVAKRHPALS 101

  Fly   267 KINRMAAQGQQTKHT-QKTETKDKDLKC---HRSEGPEGVSLEMEELPDQKDAVQKLPLPSADFT 327
            .|.|    |:|  |: .::::..::..|   .|....:.|:.|:.....||       |..:|::
  Rat   102 AIVR----GKQ--HSWHESDSFTENAPCRPLRRRRKVKRVASEVAASLQQK-------LKVSDWS 153

  Fly   328 ---TANFNSISMDTIVPVTDIDALLLSTPPAAPLLRKKAQGQAPGHSSSSS-------SKTERRR 382
               ...|.|.....:....:      :||           ..:.||....|       |||.|:.
  Rat   154 YERGCRFKSAKKQRLSRWKE------NTP-----------WTSSGHGLCESAESRTFLSKTGRKE 201

  Fly   383 RFQTFPQPQLQLQAQSMDCSELYDFLSSSSLSSSTDSEAEVGGHRRHDTDREGDDELTDW-PGNE 446
            |.:...:.|.....::|..||      :||:.||:|:     |...:|..|:||||.:|| ...|
  Rat   202 RMECEAEGQKHGSDENMSESE------TSSVCSSSDT-----GLFTNDEGRQGDDEQSDWFYEGE 255

  Fly   447 FGPGARYDPKRKLTKKSLLPQIRSDDTIGEDDTLMSGTEAGAVGMEPPSKSPVQLPESLQDLSRF 511
            ..||        .|..:|||:...|.                                       
  Rat   256 CVPG--------FTVHNLLPKWAPDH--------------------------------------- 273

  Fly   512 QPAGVSEPIEIQNACSEMETNADGTMPASRQIESEMSGETSNPFLSSSPPG----HAQ-----GQ 567
                          |:|:|           :::|.:...:.:.||..|.|.    |.:     |.
  Rat   274 --------------CTEVE-----------RMDSGLDKLSDSTFLLPSRPAQRGYHGRLNRLPGA 313

  Fly   568 EVREIRAGCRRINGERPGFSIKMSV-NERIARFLQDSQQTQIRLPDIELYETDSMSNLATLYSLT 631
            ..|.:|.|.||:.|:..|.|   |: .|||...:.|.:||...||.....|....:.|:.||||.
  Rat   314 AARCLRKGRRRLAGKETGIS---SLGTERIGHPVSDPRQTDFWLPSAGKRERHQFNPLSPLYSLD 375

  Fly   632 MVVE 635
            ::.:
  Rat   376 VLAD 379



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D273967at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14195
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.