DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik2 and SKS1

DIOPT Version :9

Sequence 1:NP_569972.1 Gene:Sik2 / 31170 FlyBaseID:FBgn0025625 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_015299.1 Gene:SKS1 / 856081 SGDID:S000005947 Length:502 Species:Saccharomyces cerevisiae


Alignment Length:467 Identity:100/467 - (21%)
Similarity:152/467 - (32%) Gaps:194/467 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 YDIERTIGKGNFAVVKLARHRITKNEVAIKIIDKS------------------------------ 175
            :.|...||.|.:.:|......:|..|.|:|.:.||                              
Yeast    10 FRITAQIGSGAYGLVFHVVDILTSREYAVKTVFKSSSMDEFYNKNGLNNNSQVARTTLLQTQLYH 74

  Fly   176 --------------------QLDQTNLQKV--YREVEIMKRLK-HPHIIKLYQVMETKNMIYIVS 217
                                ||.:..|.::  |||:....|:: |.:|:|::||:|:....:||.
Yeast    75 FFKSFQKKLFLPSVDLDSILQLTENELNRLPHYREIAFQLRVQSHGNIVKIHQVLESSIATFIVM 139

  Fly   218 EYASQGEIFDYIAKYGRMSESAARFK--FWQIISAVEYCHKKGIVHRDLKAENLLLDLNMNIKIA 280
            :|..: ::|..|.............|  |.|:.||:::||:.||.|.|:|.||:|||.|.|..:.
Yeast   140 DYYDR-DLFTSIVDDKHFVNHGILIKKVFLQLCSALDHCHRLGIYHCDIKPENVLLDRNDNAYLC 203

  Fly   281 DFGFSNHFKPGELLATWCGSPPYAAPEVFEGKQ-YTGPEI------------------------- 319
            |||.|...|             |.||.|..|.. |..||.                         
Yeast   204 DFGLSTKSK-------------YLAPNVCVGSSYYMAPERILYCLNTTTNGIHVDECCSSLPTDT 255

  Fly   320 -DIWSLGVVLYVLVCGALPF----------------DGSTLQSLRDRVLSGRFRIPFFMSSECEH 367
             ||||||::|..|.|...|:                |.:.|:.:          :|  :|.|...
Yeast   256 GDIWSLGIILINLTCIRNPWLKAHQKEDNTFQHFANDNNVLKKI----------LP--ISDELFT 308

  Fly   368 LIRRMLVLEPTRRYTIDQIKRHRWMCPELLEHVLIAKYNLGAERQTSVEPSEDILRIMAEYVGIG 432
            ::.::|.|.|..|.                                      |:..:|:|...:.
Yeast   309 VLTKILQLNPYTRI--------------------------------------DMKTLMSEVSSLT 335

  Fly   433 SDKTRAS-------LKKNTY-DHVAAIYLLLQDRVSHKKEQSNGLGASALASSTSASRMIYSSRN 489
            | .||..       |....| .|:.....|....:||                       :|:..
Yeast   336 S-FTREGPLSQVPILSSEVYMTHIIRNENLFLSDLSH-----------------------FSADQ 376

  Fly   490 DHQPTQQQSQQQ 501
            :.|..|||.|||
Yeast   377 EQQQQQQQQQQQ 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik2NP_569972.1 STKc_SIK 140..392 CDD:270973 80/348 (23%)
S_TKc 141..392 CDD:214567 80/348 (23%)
SKS1NP_015299.1 PKc_like 9..331 CDD:419665 82/384 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345285
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.