DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik2 and Gm6882

DIOPT Version :9

Sequence 1:NP_569972.1 Gene:Sik2 / 31170 FlyBaseID:FBgn0025625 Length:1398 Species:Drosophila melanogaster
Sequence 2:XP_017167971.1 Gene:Gm6882 / 628475 MGIID:3645601 Length:313 Species:Mus musculus


Alignment Length:314 Identity:125/314 - (39%)
Similarity:179/314 - (57%) Gaps:35/314 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LKLKEPMRVGFYDIE----------RTIGKGNFAVVKLARHRITKNEVAIKIIDKSQLDQTNLQK 184
            ||:.|......|.||          .|:|:|||:|||.|.|..|...||:||:..:: :.|:  .
Mouse    13 LKMMEQDLKACYSIEENFDINYKMLNTLGEGNFSVVKRAFHVPTSTSVAVKILQNTK-EYTS--P 74

  Fly   185 VYREVEIMKRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIIS 249
            :.||..|||.|.||:||||:.|::.:...|:|.||||:||:.|.|...|.:.||..|..|.||:.
Mouse    75 ICREARIMKSLSHPNIIKLFHVVQRRETTYLVMEYASEGELLDRIINVGSLEESETRRLFAQIVH 139

  Fly   250 AVEYCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELLATWCGSPPYAAPEVFEGKQY 314
            ||:|||...|||||:||.|:|:|...|.|:.|||.:....||:.||.:||:.||.|||..:.::|
Mouse   140 AVQYCHDHHIVHRDIKASNILIDCRGNAKLCDFGLAAEVIPGQKLAGFCGTLPYCAPEHLQAEKY 204

  Fly   315 TGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIPFFMSSECEHLIRRMLVLEPTR 379
            .|..:|||||||:|:::|.|.|||.|.:...|:..::|..|.||..:|.:..::|..:|::.|:|
Mouse   205 EGLPVDIWSLGVLLFLMVSGNLPFQGRSFVDLKQEIISANFSIPSHVSIDISNVIIELLMINPSR 269

  Fly   380 RYTIDQIKRHRWMCPELLEHVLIAKYNLGAER---QTSVE-----PSEDILRIM 425
            |.||.||.||..:              .|:|.   .||.:     ||..|:|.|
Mouse   270 RPTIHQIMRHPMI--------------RGSEACLPPTSTQTFPGTPSHSIVRTM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik2NP_569972.1 STKc_SIK 140..392 CDD:270973 113/261 (43%)
S_TKc 141..392 CDD:214567 113/260 (43%)
Gm6882XP_017167971.1 STKc_AMPK-like 33..280 CDD:270905 109/249 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.