DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik2 and CG17698

DIOPT Version :9

Sequence 1:NP_569972.1 Gene:Sik2 / 31170 FlyBaseID:FBgn0025625 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster


Alignment Length:474 Identity:119/474 - (25%)
Similarity:207/474 - (43%) Gaps:97/474 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 STPGPSPTSS------------AVGAGGISGKDLLKLKEPMRVGFYDIERTIGKGNFAVVKLARH 160
            |||..||.||            ::...|    ..|:|.:      |.:...||:|::.:||||..
  Fly   248 STPFSSPRSSRRKPAFRESRRISIDKSG----SFLQLNQ------YRLMEQIGQGSYGLVKLAYS 302

  Fly   161 RITKNEVAIKIIDKSQL-------------DQTNLQKVYREVEIMKRLKHPHIIKLYQVME--TK 210
            .......|:||:.|.:|             ..:.|.:||||:.::|:|.||:::||.:|::  .:
  Fly   303 EEDSTHYAMKILSKKRLLRQAGLMRRGPRKATSPLDRVYREIAVLKKLDHPNVVKLVEVLDDPLE 367

  Fly   211 NMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVEY------------------CHKK 257
            :.:|:|.|...|||:. .|.....:||..|...|.:.:..:||                  .|.:
  Fly   368 DSLYMVFELVKQGEVL-RIPTDNPLSEKRAWSIFRESLLGLEYYTMLSSSAISLKRIFVYTVHHQ 431

  Fly   258 GIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELL---ATWCGSPPYAAPE-VFEGK-QYTGP 317
            .|:|.|:|..||||....::||||.|..|.|...:..   .:..|:|.:.||| :..|: :|.|.
  Fly   432 KIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAGTPAFRAPETLIPGQNEYCGR 496

  Fly   318 EIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIP--FFMSSECEHLIRRMLVLEPTRR 380
            ..|:|:||..||.|:.|.:||...::..|.:::.....:.|  ..::...:..|.:||...||:|
  Fly   497 AADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPENHKVTENLKSCIVQMLEKNPTQR 561

  Fly   381 YTIDQIKRHRWMCPELLEHVLIAKYNLGAER------QTSVEPSEDILRIMAEYVGIGSDKTRAS 439
            .||.|:|..:|:..:       ..|.|..|.      |...|..:.::|.:.:...:...||  .
  Fly   562 ITIPQLKTSKWVTSD-------GDYPLPTEEENCCLVQVDDEDIDSVVRSIPKLDTLILIKT--M 617

  Fly   440 LKKNTYDHVAAIYLLLQDRVSHKKEQSNGLGASALASSTSASRMIYSSRNDHQP---TQQQSQQQ 501
            |||:::.:...             :..:|. :|:||..:...|.|.:.|::..|   ....::|.
  Fly   618 LKKHSFGNPFV-------------KGCSGT-SSSLAGCSRIERFIRAGRSNSAPGSYHMSTARQP 668

  Fly   502 SKTISTSSIL--AKDQCHK 518
            |......|::  ...||::
  Fly   669 SSDTLLPSLMEHCSTQCNE 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik2NP_569972.1 STKc_SIK 140..392 CDD:270973 84/291 (29%)
S_TKc 141..392 CDD:214567 84/290 (29%)
CG17698NP_001036633.2 S_TKc 283..573 CDD:214567 84/290 (29%)
STKc_CAMKK 288..574 CDD:271020 84/286 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.