DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik2 and CG10177

DIOPT Version :9

Sequence 1:NP_569972.1 Gene:Sik2 / 31170 FlyBaseID:FBgn0025625 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster


Alignment Length:248 Identity:75/248 - (30%)
Similarity:133/248 - (53%) Gaps:23/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 RITKNEVAIKIIDKSQLDQTNLQKVYREVEIMKRLK-HPHIIKLYQVMETKNMIYIVSEYASQGE 224
            |..:.:..:|:::| |....:....|.|.|::::|: ||:||:|...:|.:..:|.|.|:. ...
  Fly   169 RANRTKCTVKMVNK-QTQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHL-DCN 231

  Fly   225 IFDYIAKYGRMSESAARFKFWQIISAVEYCHKKGIVHRDLKAENLLL-------DLNMNIKIADF 282
            :...|.|.|.:||:.||......:||:.:.|:..::|||:|.||||:       :..| :|:|:|
  Fly   232 MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKM-VKVANF 295

  Fly   283 GFSNHFKPGELLATWCGSPPYAAPEV--FEGKQYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQS 345
            ..:.::: |..|...||:|.|.|||:  ..|..|   ::|.|||||.|:.::||.:||..:...|
  Fly   296 DLATYYR-GSKLYVRCGTPCYMAPEMIAMSGYDY---QVDSWSLGVTLFYMLCGKMPFASACKNS 356

  Fly   346 --LRDRVLSGRFRIP----FFMSSECEHLIRRMLVLEPTRRYTIDQIKRHRWM 392
              :...::||....|    ..||.|...||..:||.:|:.|..|.::.:.:::
  Fly   357 KEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELDKFQFL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik2NP_569972.1 STKc_SIK 140..392 CDD:270973 75/246 (30%)
S_TKc 141..392 CDD:214567 75/246 (30%)
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 75/246 (30%)
PKc_like 164..403 CDD:304357 75/240 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.