DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik2 and grp

DIOPT Version :9

Sequence 1:NP_569972.1 Gene:Sik2 / 31170 FlyBaseID:FBgn0025625 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster


Alignment Length:440 Identity:123/440 - (27%)
Similarity:195/440 - (44%) Gaps:75/440 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 TSSAVGAGGISGKDLLKLKEPMRVGFYDIERTIGKGNFAVVKLARHRITKNEVAIKIID-KSQLD 178
            |.:..|.|..:.::.        |..:.:.:|:|:|.:..|||..:|.|...||:|::| |...|
  Fly     4 TLTEAGTGPAATREF--------VEGWTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKKHPD 60

  Fly   179 QTNLQKVYREVEIMKRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFK 243
            ..|  .|.:||.|.|.|:..||::.:......::.||..|||:.||:||.|.....|.:..|:..
  Fly    61 AAN--SVRKEVCIQKMLQDKHILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRY 123

  Fly   244 FWQIISAVEYCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFK---PGELLATWCGSPPYAA 305
            |.|::|.:.|.|::||.|||||.||||||.:.|:||:|||.:..|:   ...||...||:.||.|
  Fly   124 FTQLLSGLNYLHQRGIAHRDLKPENLLLDEHDNVKISDFGMATMFRCKGKERLLDKRCGTLPYVA 188

  Fly   306 PEVFEGKQYTGPEIDIWSLGVVLYVLVCGALPFDG-----STLQSLRDRVLSGRFRIPFF-MSSE 364
            |||.: |.|.....|:||.||:|..::.|.||:|.     :...:.||.. ..:.:.|:. :.:.
  Fly   189 PEVLQ-KAYHAQPADLWSCGVILVTMLAGELPWDQPSTNCTEFTNWRDND-HWQLQTPWSKLDTL 251

  Fly   365 CEHLIRRMLVLEPTRRYTIDQIKRHRWMCPELLEHVLIAKYNLGAERQTSVEPSEDILRIMAEYV 429
            ...|:|::|...|..|.|:::...|:|...:..::          ||...:..|...|.|.    
  Fly   252 AISLLRKLLATSPGTRLTLEKTLDHKWCNMQFADN----------ERSYDLVDSAAALEIC---- 302

  Fly   430 GIGSDKTRASLKKNTYDHVAAIYLLLQDRVSHKKEQSNGLGASALASSTSASRMIYSSRN-DHQP 493
               |.|.:                  :.|:......||||..|.             ||| ..||
  Fly   303 ---SPKAK------------------RQRLQSSAHLSNGLDDSI-------------SRNYCSQP 333

  Fly   494 TQQQSQQQSKTISTSSILAKDQCHKRLSRHQTVLMSERNAHAGATPTVPD 543
            ...........:...|..:|:....|    ||:....|.:::.:.|.:.|
  Fly   334 MPTMRSDDDFNVRLGSGRSKEDGGDR----QTLAQEARLSYSFSQPALLD 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik2NP_569972.1 STKc_SIK 140..392 CDD:270973 92/261 (35%)
S_TKc 141..392 CDD:214567 92/260 (35%)
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 92/262 (35%)
S_TKc 22..278 CDD:214567 92/259 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.