DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment moody and Gpr84

DIOPT Version :9

Sequence 1:NP_001188534.1 Gene:moody / 31168 FlyBaseID:FBgn0025631 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001102979.1 Gene:Gpr84 / 688730 RGDID:1585277 Length:396 Species:Rattus norvegicus


Alignment Length:376 Identity:94/376 - (25%)
Similarity:176/376 - (46%) Gaps:47/376 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FAAVMTFLIMIVGICGNLLTVVALLKCPKVRNVAAAFIISLCIADLLFCALVLPFQGLRFVQGTW 102
            ||.:...::...|..||:||::||...||:|......|.:|.:||||:|.|:.||....::...|
  Rat    22 FAVIWGMVVAATGTVGNVLTLLALAIRPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHW 86

  Fly   103 RHGQVLCRLIPFIQYGNIGVSLLCIAMITINRYVMITHHGLYARIYKRHWIAVMIAACWLFSYGM 167
            |.|.:.||:...:.:.:..||:|.:.:|.:.||::|.|..|:.:::....|.:.:...|:.....
  Rat    87 RTGAIFCRIFGLLLFTSNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVGSWVVGVTS 151

  Fly   168 QLPTLLGEWGRFGYDSRLQTCSIMTDDHGHSSKTTLFITAFVIPCLVIIACYAKIFWVVHKSEQR 232
            ..|.    |..:.....:.|||.  |.......||:.:..|.:..|..:..:   :.::|:..:|
  Rat   152 FAPL----WNVYVLVPVVCTCSF--DRVRGRPYTTILMGIFFVVGLSSVGVF---YCLIHRQVKR 207

  Fly   233 LKRHATK----------------QNSIPNNLRPLASTGSGALPS-GAECQPSNRVSSDSSSSFSI 280
            ..|...|                ..::|.:.:.|.|..:...|| |...:|   ||:.::.:...
  Rat   208 AARALDKYGLQEASMRSHQVSGTHEAVPGHFQELDSGLASRGPSEGISSEP---VSAATTQTLEG 269

  Fly   281 DVPETAPSGKQQPTRVKDQR---EVRAKR-------------NEW-RITKMVLAIFLSFVVCYLP 328
            |..|....|.::..:...:|   ||..|.             :|: ::|:|..|:||.||:.|:|
  Rat   270 DSSEAGDQGMRKAAQQISERSLPEVHRKTGGAAGARRATDAPSEFGKVTRMCFAVFLCFVLSYIP 334

  Fly   329 ITIVKVADKNVEHPS-LHICSYILLYLSACINPIIYVIMNKQYRKAYKTVV 378
            ..::.:.|.....|. :|:.:..|.:|::||||::|..||:|:|:||.:::
  Rat   335 FLLLNILDARGRAPRVVHMVAANLTWLNSCINPVLYAAMNRQFRQAYGSIL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
moodyNP_001188534.1 7tm_4 44..>167 CDD:304433 36/122 (30%)
7tm_1 53..363 CDD:278431 84/344 (24%)
7tm_4 <310..380 CDD:304433 25/70 (36%)
Gpr84NP_001102979.1 7tm_4 29..>171 CDD:304433 41/147 (28%)
7tm_1 37..>210 CDD:278431 47/181 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4212
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321514at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45703
orthoMCL 1 0.900 - - OOG6_109002
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4815
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.