DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment moody and BDKRB1

DIOPT Version :9

Sequence 1:NP_001188534.1 Gene:moody / 31168 FlyBaseID:FBgn0025631 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_000701.2 Gene:BDKRB1 / 623 HGNCID:1029 Length:353 Species:Homo sapiens


Alignment Length:402 Identity:82/402 - (20%)
Similarity:152/402 - (37%) Gaps:92/402 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LEDGYPPLEALT---TMVPPADATGFSQSL----LTFAAVMTFLIMI--VGICGNLLTVVALLKC 64
            :...:||||..:   :.:.|.:||....:.    |....:.||:|.|  .|:.|||..::..|..
Human     1 MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLLVFLLP 65

  Fly    65 PKVRNVAAAFIISLCIADLLFCALVLPFQGLR-FVQGTWRHGQVLCRLIPFIQYGNIGVSLLCIA 128
            .:..|||..::.:|..:||:| .|.|||.... :.|..|..|.:|||:|..:...|:.:|:..:.
Human    66 RRQLNVAEIYLANLAASDLVF-VLGLPFWAENIWNQFNWPFGALLCRVINGVIKANLFISIFLVV 129

  Fly   129 MITINRYVMITHHGLYARIYKRHWIAVMIAACWLFSYGMQLPTLLGEWGRFGYDSRLQTCSIMTD 193
            .|:.:||.::.|.....|..:|....|.....|:....:.:||.|....:...|..:..|.::..
Human   130 AISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQAVPDLNITACILLLP 194

  Fly   194 DHG-HSSK-TTLFITAFVIPCLVIIACYAKIFWVVHKSEQRLKRHATKQNSIPNNLRPLASTGSG 256
            ... |.:: ..|.|..|::|...|      :|:..|               |..:||        
Human   195 HEAWHFARIVELNILGFLLPLAAI------VFFNYH---------------ILASLR-------- 230

  Fly   257 ALPSGAECQPSNRVSSDSSSSFSIDVPETAPSGKQQPTRVKDQREVRAKRNEWRITKMVLAIFLS 321
                                                 ||.:..|.....|.:.:.|.::|.:.::
Human   231 -------------------------------------TREEVSRTRCGGRKDSKTTALILTLVVA 258

  Fly   322 FVVCYLPITIVKVADKNVEHPSLHICSY------------ILLYLSACINPIIYVIMNKQYR-KA 373
            |:||:.|.......:...:..::..|.:            ...:.::.:||:|||.:.:.:| |.
Human   259 FLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFFAFTNSSLNPVIYVFVGRLFRTKV 323

  Fly   374 YKTVVFCQPARL 385
            ::....|.|..|
Human   324 WELYKQCTPKSL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
moodyNP_001188534.1 7tm_4 44..>167 CDD:304433 36/125 (29%)
7tm_1 53..363 CDD:278431 61/324 (19%)
7tm_4 <310..380 CDD:304433 14/82 (17%)
BDKRB1NP_000701.2 7tmA_BK-1 38..323 CDD:320502 70/351 (20%)
TM helix 1 40..64 CDD:320502 8/23 (35%)
TM helix 2 73..94 CDD:320502 8/21 (38%)
TM helix 3 111..133 CDD:320502 5/21 (24%)
TM helix 4 156..172 CDD:320502 2/15 (13%)
TM helix 5 200..223 CDD:320502 6/28 (21%)
TM helix 6 249..271 CDD:320502 6/21 (29%)
TM helix 7 291..316 CDD:320502 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.