DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment moody and MTNR1B

DIOPT Version :9

Sequence 1:NP_001188534.1 Gene:moody / 31168 FlyBaseID:FBgn0025631 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_005950.1 Gene:MTNR1B / 4544 HGNCID:7464 Length:362 Species:Homo sapiens


Alignment Length:363 Identity:84/363 - (23%)
Similarity:149/363 - (41%) Gaps:83/363 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PPADATGFSQSLLTFAAVMTFLIMIVGICGNLLTVVALLKCPKVRNVAAAFIISLCIADLLFCAL 88
            ||..|...|..|:...|        |.:.||||.::::|:..|:||....|::||.:|||:....
Human    36 PPWVAPALSAVLIVTTA--------VDVVGNLLVILSVLRNRKLRNAGNLFLVSLALADLVVAFY 92

  Fly    89 VLPFQGLRFVQGTWRHGQVLCRLIPFIQYGNIGVSLLCIAMITINRYVMITHHGLYARIYKRHWI 153
            ..|...:......|..|:..|:...|:...::..|:..|..|.||||..|.|...|.|||:|...
Human    93 PYPLILVAIFYDGWALGEEHCKASAFVMGLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHT 157

  Fly   154 AVMIAACWLFSYGMQLPTLLGEWGRFGYDSRLQTCS-IMTDDHGHSSKTTLFITAFVIPCLVIIA 217
            .:.|...||.:....||...  .|...||.|:.:|: |.|....:::  .:.:..|::|..|:..
Human   158 PLHICLIWLLTVVALLPNFF--VGSLEYDPRIYSCTFIQTASTQYTA--AVVVIHFLLPIAVVSF 218

  Fly   218 CYAKIFWVVHKSEQRLKRHATKQNSIPNNLRPLASTGSGALPSGAECQPSNRVSSDSSSSFSIDV 282
            ||.:| ||:                              .|.:..:.:|.:|:.           
Human   219 CYLRI-WVL------------------------------VLQARRKAKPESRLC----------- 241

  Fly   283 PETAPSGKQQPTRVKDQREVRAKRNEWRITKMVLAIFLSFVVCYLPITIVKVA------DKNVEH 341
                                 .|.::.|....:..:|:.|.:|:.|:..:.:|      :...:.
Human   242 ---------------------LKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQI 285

  Fly   342 P-SLHICSYILLYLSACINPIIYVIMNKQYRKAYKTVV 378
            | .|.:.||:|.|.::|:|.|:|.::|:.:|:.||.::
Human   286 PEGLFVTSYLLAYFNSCLNAIVYGLLNQNFRREYKRIL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
moodyNP_001188534.1 7tm_4 44..>167 CDD:304433 37/122 (30%)
7tm_1 53..363 CDD:278431 72/317 (23%)
7tm_4 <310..380 CDD:304433 20/76 (26%)
MTNR1BNP_005950.1 7tm_4 48..>192 CDD:304433 45/153 (29%)
7tm_1 57..308 CDD:278431 72/317 (23%)
7tm_4 <131..>261 CDD:304433 39/196 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5405
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I4405
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4597
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.